Recombinant Human ARL3, His-tagged
| Cat.No. : | ARL3-26179TH |
| Product Overview : | Recombinant full-length Human ARL3 with a N terminal His tag. 206 amino acids with a predicted MWt 23 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 182 amino acids |
| Description : | ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. |
| Conjugation : | HIS |
| Molecular Weight : | 23.000kDa inclusive of tags |
| Tissue specificity : | Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level). |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK |
| Sequence Similarities : | Belongs to the small GTPase superfamily. Arf family. |
| Gene Name | ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ] |
| Official Symbol | ARL3 |
| Synonyms | ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3; |
| Gene ID | 403 |
| mRNA Refseq | NM_004311 |
| Protein Refseq | NP_004302 |
| MIM | 604695 |
| Uniprot ID | P36405 |
| Chromosome Location | 10q23.3 |
| Function | GDP binding; GTP binding; metal ion binding; microtubule binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| ARL3-1192HF | Recombinant Full Length Human ARL3 Protein, GST-tagged | +Inquiry |
| ARL3-6872H | Recombinant Human ADP-Ribosylation Factor-Like 3, His-tagged | +Inquiry |
| ARL3-438R | Recombinant Rat ARL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL3-810H | Recombinant Human ARL3 protein, GST-tagged | +Inquiry |
| ARL3-9856H | Recombinant Human ARL3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL3-8714HCL | Recombinant Human ARL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL3 Products
Required fields are marked with *
My Review for All ARL3 Products
Required fields are marked with *
