Recombinant Human ARL3, His-tagged

Cat.No. : ARL3-26179TH
Product Overview : Recombinant full-length Human ARL3 with a N terminal His tag. 206 amino acids with a predicted MWt 23 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 182 amino acids
Description : ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.
Conjugation : HIS
Molecular Weight : 23.000kDa inclusive of tags
Tissue specificity : Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level).
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Sequence Similarities : Belongs to the small GTPase superfamily. Arf family.
Gene Name ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ]
Official Symbol ARL3
Synonyms ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3;
Gene ID 403
mRNA Refseq NM_004311
Protein Refseq NP_004302
MIM 604695
Uniprot ID P36405
Chromosome Location 10q23.3
Function GDP binding; GTP binding; metal ion binding; microtubule binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL3 Products

Required fields are marked with *

My Review for All ARL3 Products

Required fields are marked with *

0
cart-icon