Recombinant Human ARL4C protein, GST-tagged
Cat.No. : | ARL4C-812H |
Product Overview : | Human ARL4C full-length ORF ( NP_005728.2, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL4C ADP-ribosylation factor-like 4C [ Homo sapiens ] |
Official Symbol | ARL4C |
Synonyms | LAK; ARL7 |
Gene ID | 10123 |
mRNA Refseq | NM_005737.3 |
Protein Refseq | NP_005728.2 |
MIM | 604787 |
UniProt ID | P56559 |
◆ Recombinant Proteins | ||
ARL4C-3217H | Recombinant Human ARL4C, His-tagged | +Inquiry |
ARL4C-9858H | Recombinant Human ARL4C, GST-tagged | +Inquiry |
ARL4C-1106HF | Recombinant Full Length Human ARL4C Protein, GST-tagged | +Inquiry |
Arl4c-3216M | Recombinant Mouse Arl4c, His-tagged | +Inquiry |
ARL4C-723M | Recombinant Mouse ARL4C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL4C-8712HCL | Recombinant Human ARL4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4C Products
Required fields are marked with *
My Review for All ARL4C Products
Required fields are marked with *