Recombinant Human ARL4C protein, GST-tagged
| Cat.No. : | ARL4C-812H |
| Product Overview : | Human ARL4C full-length ORF ( NP_005728.2, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 47.9 kDa |
| AA Sequence : | MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL4C ADP-ribosylation factor-like 4C [ Homo sapiens ] |
| Official Symbol | ARL4C |
| Synonyms | LAK; ARL7 |
| Gene ID | 10123 |
| mRNA Refseq | NM_005737.3 |
| Protein Refseq | NP_005728.2 |
| MIM | 604787 |
| UniProt ID | P56559 |
| ◆ Recombinant Proteins | ||
| ARL4C-812H | Recombinant Human ARL4C protein, GST-tagged | +Inquiry |
| Arl4c-1707M | Recombinant Mouse Arl4c Protein, Myc/DDK-tagged | +Inquiry |
| ARL4C-9858H | Recombinant Human ARL4C, GST-tagged | +Inquiry |
| ARL4C-1106HF | Recombinant Full Length Human ARL4C Protein, GST-tagged | +Inquiry |
| ARL4C-1932M | Recombinant Mouse ARL4C Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL4C-8712HCL | Recombinant Human ARL4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4C Products
Required fields are marked with *
My Review for All ARL4C Products
Required fields are marked with *



