Recombinant Human ARL6 protein, GST-tagged
Cat.No. : | ARL6-816H |
Product Overview : | Human ARL6 full-length ORF ( AAH24239, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). [provided by RefSeq, Apr 2016] |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL6 ADP ribosylation factor like GTPase 6 [ Homo sapiens (human) ] |
Official Symbol | ARL6 |
Synonyms | ARL6; ADP ribosylation factor like GTPase 6; BBS3; RP55; ADP-ribosylation factor-like protein 6; Bardet-Biedl syndrome 3 protein; |
Gene ID | 84100 |
mRNA Refseq | NM_001278293 |
Protein Refseq | NP_001265222 |
MIM | 608845 |
UniProt ID | Q9H0F7 |
◆ Recombinant Proteins | ||
Arl6-1709M | Recombinant Mouse Arl6 Protein, Myc/DDK-tagged | +Inquiry |
ARL6-232R | Recombinant Rhesus Macaque ARL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL6-2487C | Recombinant Chicken ARL6 | +Inquiry |
ARL6-622H | Recombinant Human ARL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARL6-1943Z | Recombinant Zebrafish ARL6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL6-8708HCL | Recombinant Human ARL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6 Products
Required fields are marked with *
My Review for All ARL6 Products
Required fields are marked with *