Recombinant Human ARL6 protein, GST-tagged

Cat.No. : ARL6-816H
Product Overview : Human ARL6 full-length ORF ( AAH24239, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). [provided by RefSeq, Apr 2016]
Molecular Mass : 46.2 kDa
AA Sequence : MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL6 ADP ribosylation factor like GTPase 6 [ Homo sapiens (human) ]
Official Symbol ARL6
Synonyms ARL6; ADP ribosylation factor like GTPase 6; BBS3; RP55; ADP-ribosylation factor-like protein 6; Bardet-Biedl syndrome 3 protein;
Gene ID 84100
mRNA Refseq NM_001278293
Protein Refseq NP_001265222
MIM 608845
UniProt ID Q9H0F7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL6 Products

Required fields are marked with *

My Review for All ARL6 Products

Required fields are marked with *

0
cart-icon