Recombinant Human ARL6IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARL6IP1-6509H
• Product Overview: ARL6IP1 MS Standard C13 and N15-labeled recombinant protein (NP_055976) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 23.4 kDa
• AA Sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARL6IP1 ADP-ribosylation factor-like 6 interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: ARL6IP1
• Synonyms: ARL6IP1; ADP-ribosylation factor-like 6 interacting protein 1; ADP ribosylation factor like 6 interacting protein, ARL6IP; ADP-ribosylation factor-like protein 6-interacting protein 1; AIP1; ARMER; KIAA0069; aip-1; ARL-6-interacting protein 1; apoptotic regulator in the membrane of the endoplasmic reticulum; ARL6IP
• Gene ID: 23204
• mRNA Refseq: NM_015161
• Protein Refseq: NP_055976
• MIM: 607669
• UniProt ID: Q15041