Recombinant Human ARL6IP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARL6IP1-6509H |
Product Overview : | ARL6IP1 MS Standard C13 and N15-labeled recombinant protein (NP_055976) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARL6IP1 ADP-ribosylation factor-like 6 interacting protein 1 [ Homo sapiens (human) ] |
Official Symbol | ARL6IP1 |
Synonyms | ARL6IP1; ADP-ribosylation factor-like 6 interacting protein 1; ADP ribosylation factor like 6 interacting protein, ARL6IP; ADP-ribosylation factor-like protein 6-interacting protein 1; AIP1; ARMER; KIAA0069; aip-1; ARL-6-interacting protein 1; apoptotic regulator in the membrane of the endoplasmic reticulum; ARL6IP; |
Gene ID | 23204 |
mRNA Refseq | NM_015161 |
Protein Refseq | NP_055976 |
MIM | 607669 |
UniProt ID | Q15041 |
◆ Recombinant Proteins | ||
RFL17451MF | Recombinant Full Length Mouse Adp-Ribosylation Factor-Like Protein 6-Interacting Protein 1(Arl6Ip1) Protein, His-Tagged | +Inquiry |
ARL6IP1-9861H | Recombinant Human ARL6IP1, GST-tagged | +Inquiry |
ARL6IP-817H | Recombinant Human ARL6IP protein, GST-tagged | +Inquiry |
ARL6IP1-1321C | Recombinant Chicken ARL6IP1 | +Inquiry |
ARL6IP1-11334Z | Recombinant Zebrafish ARL6IP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL6IP1-8707HCL | Recombinant Human ARL6IP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL6IP1 Products
Required fields are marked with *
My Review for All ARL6IP1 Products
Required fields are marked with *
0
Inquiry Basket