Recombinant Human ARL6IP4 protein, GST-tagged
Cat.No. : | ARL6IP4-819H |
Product Overview : | Human ARL6IP4 partial ORF ( NP_061164, 261 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARL6IP4 (ADP Ribosylation Factor Like GTPase 6 Interacting Protein 4) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL6IP4 ADP-ribosylation-like factor 6 interacting protein 4 [ Homo sapiens ] |
Official Symbol | ARL6IP4 |
Synonyms | ARL6IP4; ADP-ribosylation-like factor 6 interacting protein 4; ADP-ribosylation factor-like protein 6-interacting protein 4; SFRS20; splicing factor; arginine/serine rich 20; SR 25; SRp25; SRp25 nuclear protein; SRrp37; SR-15; aip-4; HSP-975; HSVI binding protein; HSVI-binding protein; splicing regulator SRrp38; ARL-6-interacting protein 4; splicing factor, arginine/serine-rich 20; SR-25; MGC814; |
Gene ID | 51329 |
mRNA Refseq | NM_001002251 |
Protein Refseq | NP_001002251 |
MIM | 607668 |
UniProt ID | Q66PJ3 |
◆ Recombinant Proteins | ||
ARL6IP4-819H | Recombinant Human ARL6IP4 protein, GST-tagged | +Inquiry |
ARL6IP4-1939M | Recombinant Mouse ARL6IP4 Protein | +Inquiry |
ARL6IP4-785R | Recombinant Rat ARL6IP4 Protein | +Inquiry |
ARL6IP4-727M | Recombinant Mouse ARL6IP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL6IP4-2898Z | Recombinant Zebrafish ARL6IP4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL6IP4-123HCL | Recombinant Human ARL6IP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL6IP4 Products
Required fields are marked with *
My Review for All ARL6IP4 Products
Required fields are marked with *
0
Inquiry Basket