Recombinant Human ARL6IP4 protein, GST-tagged

Cat.No. : ARL6IP4-819H
Product Overview : Human ARL6IP4 partial ORF ( NP_061164, 261 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARL6IP4 (ADP Ribosylation Factor Like GTPase 6 Interacting Protein 4) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
Molecular Mass : 36.74 kDa
AA Sequence : PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL6IP4 ADP-ribosylation-like factor 6 interacting protein 4 [ Homo sapiens ]
Official Symbol ARL6IP4
Synonyms ARL6IP4; ADP-ribosylation-like factor 6 interacting protein 4; ADP-ribosylation factor-like protein 6-interacting protein 4; SFRS20; splicing factor; arginine/serine rich 20; SR 25; SRp25; SRp25 nuclear protein; SRrp37; SR-15; aip-4; HSP-975; HSVI binding protein; HSVI-binding protein; splicing regulator SRrp38; ARL-6-interacting protein 4; splicing factor, arginine/serine-rich 20; SR-25; MGC814;
Gene ID 51329
mRNA Refseq NM_001002251
Protein Refseq NP_001002251
MIM 607668
UniProt ID Q66PJ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL6IP4 Products

Required fields are marked with *

My Review for All ARL6IP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon