Recombinant Human ARL6IP5 protein, His/SUMO-tagged
Cat.No. : | ARL6IP5-95H |
Product Overview : | Recombinant Human ARL6IP5(1-188 aa) fused with His/SUMO tag was expressed in E.coli cell free. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-188 aa |
Description : | ex |
Form : | Tris-based buffer, 50% glycerol |
AA Sequence : | MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Gene Name | ARL6IP5 ADP-ribosylation-like factor 6 interacting protein 5 [ Homo sapiens ] |
Official Symbol | ARL6IP5 |
Synonyms | ARL6IP5; ADP-ribosylation-like factor 6 interacting protein 5; PRA1 family protein 3; DERP11; GTRAP3 18; HSPC127; JWA; PRA1 domain family 3; PRAF3; JM5; aip-5; protein JWa; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5; jmx; hp22; addicsin; GTRAP3-18; |
Gene ID | 10550 |
mRNA Refseq | NM_006407 |
Protein Refseq | NP_006398 |
MIM | 605709 |
UniProt ID | O75915 |
Chromosome Location | 3p14 |
Function | protein C-terminus binding; |
◆ Cell & Tissue Lysates | ||
ARL6IP5-36HCL | Recombinant Human ARL6IP5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6IP5 Products
Required fields are marked with *
My Review for All ARL6IP5 Products
Required fields are marked with *
0
Inquiry Basket