Recombinant Human ARL6IP5 protein, His/SUMO-tagged
| Cat.No. : | ARL6IP5-95H |
| Product Overview : | Recombinant Human ARL6IP5(1-188 aa) fused with His/SUMO tag was expressed in E.coli cell free. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-188 aa |
| Description : | ex |
| Form : | Tris-based buffer, 50% glycerol |
| AA Sequence : | MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE |
| Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Gene Name | ARL6IP5 ADP-ribosylation-like factor 6 interacting protein 5 [ Homo sapiens ] |
| Official Symbol | ARL6IP5 |
| Synonyms | ARL6IP5; ADP-ribosylation-like factor 6 interacting protein 5; PRA1 family protein 3; DERP11; GTRAP3 18; HSPC127; JWA; PRA1 domain family 3; PRAF3; JM5; aip-5; protein JWa; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5; jmx; hp22; addicsin; GTRAP3-18; |
| Gene ID | 10550 |
| mRNA Refseq | NM_006407 |
| Protein Refseq | NP_006398 |
| MIM | 605709 |
| UniProt ID | O75915 |
| Chromosome Location | 3p14 |
| Function | protein C-terminus binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6IP5 Products
Required fields are marked with *
My Review for All ARL6IP5 Products
Required fields are marked with *



