Recombinant Human ARL8A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARL8A-1948H |
Product Overview : | ARL8A MS Standard C13 and N15-labeled recombinant protein (NP_620150) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Plays a role in lysosome motility. In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function. May play a role in chromosome segregation. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARL8A ADP-ribosylation factor-like 8A [ Homo sapiens (human) ] |
Official Symbol | ARL8A |
Synonyms | ARL8A; ADP-ribosylation factor-like 8A; ADP ribosylation factor like 10B, ARL10B; ADP-ribosylation factor-like protein 8A; FLJ45195; Gie2; ADP-ribosylation factor-like 10B; novel small G protein indispensable for equal chromosome segregation 2; GIE2; ARL10B; |
Gene ID | 127829 |
mRNA Refseq | NM_138795 |
Protein Refseq | NP_620150 |
MIM | 616597 |
UniProt ID | Q96BM9 |
◆ Recombinant Proteins | ||
ARL8A-1948H | Recombinant Human ARL8A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARL8A-2086C | Recombinant Chicken ARL8A | +Inquiry |
ARL8A-9865H | Recombinant Human ARL8A, His-tagged | +Inquiry |
ARL8A-1336HF | Recombinant Full Length Human ARL8A Protein, GST-tagged | +Inquiry |
ARL8A-730M | Recombinant Mouse ARL8A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL8A-8705HCL | Recombinant Human ARL8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL8A Products
Required fields are marked with *
My Review for All ARL8A Products
Required fields are marked with *
0
Inquiry Basket