Recombinant Human ARL8A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ARL8A-1948H |
| Product Overview : | ARL8A MS Standard C13 and N15-labeled recombinant protein (NP_620150) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Plays a role in lysosome motility. In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function. May play a role in chromosome segregation. |
| Molecular Mass : | 21.4 kDa |
| AA Sequence : | MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ARL8A ADP-ribosylation factor-like 8A [ Homo sapiens (human) ] |
| Official Symbol | ARL8A |
| Synonyms | ARL8A; ADP-ribosylation factor-like 8A; ADP ribosylation factor like 10B, ARL10B; ADP-ribosylation factor-like protein 8A; FLJ45195; Gie2; ADP-ribosylation factor-like 10B; novel small G protein indispensable for equal chromosome segregation 2; GIE2; ARL10B; |
| Gene ID | 127829 |
| mRNA Refseq | NM_138795 |
| Protein Refseq | NP_620150 |
| MIM | 616597 |
| UniProt ID | Q96BM9 |
| ◆ Recombinant Proteins | ||
| ARL8A-2086C | Recombinant Chicken ARL8A | +Inquiry |
| ARL8A-730M | Recombinant Mouse ARL8A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARL8A-1948H | Recombinant Human ARL8A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARL8A-1942M | Recombinant Mouse ARL8A Protein | +Inquiry |
| Arl8a-1711M | Recombinant Mouse Arl8a Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL8A-8705HCL | Recombinant Human ARL8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL8A Products
Required fields are marked with *
My Review for All ARL8A Products
Required fields are marked with *



