Recombinant Human ARL9 protein, GST-tagged

Cat.No. : ARL9-824H
Product Overview : Human ARL9 full-length ORF ( NP_996802.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM, Nov 2008]
Molecular Mass : 40.2 kDa
AA Sequence : MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL9 ADP ribosylation factor like GTPase 9 [ Homo sapiens (human) ]
Official Symbol ARL9
Synonyms ARL9; ADP ribosylation factor like GTPase 9; ADP-ribosylation factor-like protein 9; ADP-ribosylation factor-like 9
Gene ID 132946
mRNA Refseq NM_206919
Protein Refseq NP_996802
MIM 612405
UniProt ID Q6T311

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL9 Products

Required fields are marked with *

My Review for All ARL9 Products

Required fields are marked with *

0
cart-icon
0
compare icon