Recombinant Human ARL9 protein, GST-tagged
| Cat.No. : | ARL9-824H |
| Product Overview : | Human ARL9 full-length ORF ( NP_996802.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM, Nov 2008] |
| Molecular Mass : | 40.2 kDa |
| AA Sequence : | MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARL9 ADP ribosylation factor like GTPase 9 [ Homo sapiens (human) ] |
| Official Symbol | ARL9 |
| Synonyms | ARL9; ADP ribosylation factor like GTPase 9; ADP-ribosylation factor-like protein 9; ADP-ribosylation factor-like 9 |
| Gene ID | 132946 |
| mRNA Refseq | NM_206919 |
| Protein Refseq | NP_996802 |
| MIM | 612405 |
| UniProt ID | Q6T311 |
| ◆ Recombinant Proteins | ||
| ARL9-1345HF | Recombinant Full Length Human ARL9 Protein, GST-tagged | +Inquiry |
| Arl9-1713M | Recombinant Mouse Arl9 Protein, Myc/DDK-tagged | +Inquiry |
| ARL9-3716H | Recombinant Human ARL9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARL9-4356Z | Recombinant Zebrafish ARL9 | +Inquiry |
| ARL9-2796H | Recombinant Human ARL9 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL9-124HCL | Recombinant Human ARL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL9 Products
Required fields are marked with *
My Review for All ARL9 Products
Required fields are marked with *
