Recombinant Human ARL9 protein, GST-tagged
Cat.No. : | ARL9-824H |
Product Overview : | Human ARL9 full-length ORF ( NP_996802.1, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM, Nov 2008] |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL9 ADP ribosylation factor like GTPase 9 [ Homo sapiens (human) ] |
Official Symbol | ARL9 |
Synonyms | ARL9; ADP ribosylation factor like GTPase 9; ADP-ribosylation factor-like protein 9; ADP-ribosylation factor-like 9 |
Gene ID | 132946 |
mRNA Refseq | NM_206919 |
Protein Refseq | NP_996802 |
MIM | 612405 |
UniProt ID | Q6T311 |
◆ Recombinant Proteins | ||
ARL9-824H | Recombinant Human ARL9 protein, GST-tagged | +Inquiry |
ARL9-2796H | Recombinant Human ARL9 Protein, MYC/DDK-tagged | +Inquiry |
Arl9-1713M | Recombinant Mouse Arl9 Protein, Myc/DDK-tagged | +Inquiry |
ARL9-1337H | Recombinant Human ADP-Ribosylation Factor-Like 9, His-tagged | +Inquiry |
ARL9-1345HF | Recombinant Full Length Human ARL9 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL9-124HCL | Recombinant Human ARL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL9 Products
Required fields are marked with *
My Review for All ARL9 Products
Required fields are marked with *
0
Inquiry Basket