Recombinant Human ARMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARMC7-2693H
Product Overview : ARMC7 MS Standard C13 and N15-labeled recombinant protein (NP_078861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ARMC7 (Armadillo Repeat Containing 7) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include binding.
Molecular Mass : 21.9 kDa
AA Sequence : MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARMC7 armadillo repeat containing 7 [ Homo sapiens (human) ]
Official Symbol ARMC7
Synonyms ARMC7; armadillo repeat containing 7; armadillo repeat-containing protein 7
Gene ID 79637
mRNA Refseq NM_024585
Protein Refseq NP_078861
UniProt ID Q9H6L4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARMC7 Products

Required fields are marked with *

My Review for All ARMC7 Products

Required fields are marked with *

0
cart-icon
0
compare icon