Recombinant Human ARMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARMC7-2693H
• Product Overview: ARMC7 MS Standard C13 and N15-labeled recombinant protein (NP_078861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ARMC7 (Armadillo Repeat Containing 7) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include binding.
• Molecular Mass: 21.9 kDa
• AA Sequence: MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARMC7 armadillo repeat containing 7 [ Homo sapiens (human) ]
• Official Symbol: ARMC7
• Synonyms: ARMC7; armadillo repeat containing 7; armadillo repeat-containing protein 7
• Gene ID: 79637
• mRNA Refseq: NM_024585
• Protein Refseq: NP_078861
• UniProt ID: Q9H6L4