Recombinant Human ARMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARMC7-2693H |
Product Overview : | ARMC7 MS Standard C13 and N15-labeled recombinant protein (NP_078861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ARMC7 (Armadillo Repeat Containing 7) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include binding. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARMC7 armadillo repeat containing 7 [ Homo sapiens (human) ] |
Official Symbol | ARMC7 |
Synonyms | ARMC7; armadillo repeat containing 7; armadillo repeat-containing protein 7 |
Gene ID | 79637 |
mRNA Refseq | NM_024585 |
Protein Refseq | NP_078861 |
UniProt ID | Q9H6L4 |
◆ Recombinant Proteins | ||
ARMC7-4495Z | Recombinant Zebrafish ARMC7 | +Inquiry |
ARMC7-830H | Recombinant Human ARMC7 protein, GST-tagged | +Inquiry |
ARMC7-2693H | Recombinant Human ARMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARMC7-301142H | Recombinant Human ARMC7 protein, GST-tagged | +Inquiry |
ARMC7-5283C | Recombinant Chicken ARMC7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMC7-8700HCL | Recombinant Human ARMC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARMC7 Products
Required fields are marked with *
My Review for All ARMC7 Products
Required fields are marked with *
0
Inquiry Basket