Recombinant Human ARMC7 protein, GST-tagged

Cat.No. : ARMC7-830H
Product Overview : Human ARMC7 full-length ORF ( NP_078861.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARMC7 (Armadillo Repeat Containing 7) is a Protein Coding gene. GO annotations related to this gene include binding.
Molecular Mass : 48.3 kDa
AA Sequence : MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARMC7 armadillo repeat containing 7 [ Homo sapiens ]
Official Symbol ARMC7
Synonyms ARMC7; armadillo repeat containing 7; armadillo repeat-containing protein 7
Gene ID 79637
mRNA Refseq NM_024585.2
Protein Refseq NP_078861.1
UniProt ID Q9H6L4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARMC7 Products

Required fields are marked with *

My Review for All ARMC7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon