Recombinant Human ARMC7 protein, GST-tagged
Cat.No. : | ARMC7-830H |
Product Overview : | Human ARMC7 full-length ORF ( NP_078861.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARMC7 (Armadillo Repeat Containing 7) is a Protein Coding gene. GO annotations related to this gene include binding. |
Molecular Mass : | 48.3 kDa |
AA Sequence : | MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARMC7 armadillo repeat containing 7 [ Homo sapiens ] |
Official Symbol | ARMC7 |
Synonyms | ARMC7; armadillo repeat containing 7; armadillo repeat-containing protein 7 |
Gene ID | 79637 |
mRNA Refseq | NM_024585.2 |
Protein Refseq | NP_078861.1 |
UniProt ID | Q9H6L4 |
◆ Recombinant Proteins | ||
Armc7-1719M | Recombinant Mouse Armc7 Protein, Myc/DDK-tagged | +Inquiry |
ARMC7-4495Z | Recombinant Zebrafish ARMC7 | +Inquiry |
ARMC7-408R | Recombinant Rhesus monkey ARMC7 Protein, His-tagged | +Inquiry |
ARMC7-237R | Recombinant Rhesus Macaque ARMC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARMC7-2911H | Recombinant Human ARMC7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMC7-8700HCL | Recombinant Human ARMC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMC7 Products
Required fields are marked with *
My Review for All ARMC7 Products
Required fields are marked with *