Recombinant Human ARMC7 protein, GST-tagged
| Cat.No. : | ARMC7-830H |
| Product Overview : | Human ARMC7 full-length ORF ( NP_078861.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ARMC7 (Armadillo Repeat Containing 7) is a Protein Coding gene. GO annotations related to this gene include binding. |
| Molecular Mass : | 48.3 kDa |
| AA Sequence : | MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARMC7 armadillo repeat containing 7 [ Homo sapiens ] |
| Official Symbol | ARMC7 |
| Synonyms | ARMC7; armadillo repeat containing 7; armadillo repeat-containing protein 7 |
| Gene ID | 79637 |
| mRNA Refseq | NM_024585.2 |
| Protein Refseq | NP_078861.1 |
| UniProt ID | Q9H6L4 |
| ◆ Recombinant Proteins | ||
| ARMC7-301142H | Recombinant Human ARMC7 protein, GST-tagged | +Inquiry |
| ARMC7-2911H | Recombinant Human ARMC7 protein, His-tagged | +Inquiry |
| ARMC7-830H | Recombinant Human ARMC7 protein, GST-tagged | +Inquiry |
| ARMC7-2693H | Recombinant Human ARMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARMC7-408R | Recombinant Rhesus monkey ARMC7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARMC7-8700HCL | Recombinant Human ARMC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARMC7 Products
Required fields are marked with *
My Review for All ARMC7 Products
Required fields are marked with *



