Recombinant Human ARPC2 protein, GST-tagged

• Cat.No.: ARPC2-1207H
• Product Overview: Recombinant Human ARPC2 protein(1-300 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-300 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ARPC2 actin related protein 2/3 complex, subunit 2, 34kDa [ Homo sapiens ]
• Official Symbol: ARPC2
• Synonyms: ARPC2; actin related protein 2/3 complex, subunit 2, 34kDa; actin related protein 2/3 complex, subunit 2 (34 kD); actin-related protein 2/3 complex subunit 2; ARC34; p34 Arc; arp2/3 complex 34 kDa subunit; ARP2/3 protein complex subunit 34; PRO2446; p34-Arc; PNAS-139
• Gene ID: 10109
• mRNA Refseq: NM_005731
• Protein Refseq: NP_005722
• MIM: 604224
• UniProt ID: O15144

Q&As

Can you provide a characterization of your recombinant ARPC2 protein? Is the recombinant ARPC2 protein functional? What analysis have do you as part of the protein characterization?

The recombinant ARPC2 protein is a modified version of the natural ARPC2 protein, produced through genetic engineering techniques. ARPC2 is a subunit of the ARP2/3 protein complex, which plays a critical role in regulating actin cytoskeletal dynamics. The recombinant ARPC2 protein is typically designed for research purposes and is often used as a tool to study the function and interactions of the ARP2/3 complex. It is generated by introducing the genetic sequence of ARPC2 into a suitable expression system, such as bacteria, yeast, or mammalian cells, that can produce large quantities of the protein. The recombinant ARPC2 protein possesses similar structural and functional characteristics as the native ARPC2 protein. It typically retains the ability to interact with other subunits of the ARP2/3 complex and facilitates the formation of branched actin networks. This essential property allows researchers to investigate the mechanisms underlying actin polymerization and cytoskeletal remodeling in various biological processes. Moreover, the recombinant ARPC2 protein can be tagged with specific markers, such as fluorescent tags or affinity tags, to enable easy detection, purification, and visualization. This versatility enhances the utility of the protein in experimental studies. Overall, the recombinant ARPC2 protein serves as a valuable tool for understanding the cellular processes governed by the ARP2/3 complex and provides insights into its involvement in various physiological and pathological conditions. Our routine QC of ARPC2 protein includes BCA, SDS-PAGE, Western Blot, and Endotoxin detection. Here below are the optional services, case to case. Activity Test; HPLC; SEC; Protein Biotinylation; Protein labeling/conjugation.