Recombinant Human ARPC2 protein, GST-tagged

Species :	Human
Source :	E.coli
Tag :	GST
Protein Length :	1-300 aa
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence :	MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Purity :	95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	ARPC2 actin related protein 2/3 complex, subunit 2, 34kDa [ Homo sapiens ]
Official Symbol	ARPC2
Synonyms	ARPC2; actin related protein 2/3 complex, subunit 2, 34kDa; actin related protein 2/3 complex, subunit 2 (34 kD); actin-related protein 2/3 complex subunit 2; ARC34; p34 Arc; arp2/3 complex 34 kDa subunit; ARP2/3 protein complex subunit 34; PRO2446; p34-Arc; PNAS-139;
Gene ID	10109
mRNA Refseq	NM_005731
Protein Refseq	NP_005722
MIM	604224
UniProt ID	O15144