Recombinant Human ARPC3 protein, GST-tagged

Cat.No. : ARPC3-847H
Product Overview : Human ARPC3 full-length ORF ( NP_005710.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013]
Molecular Mass : 46.9 kDa
AA Sequence : MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa [ Homo sapiens ]
Official Symbol ARPC3
Synonyms ARPC3; actin related protein 2/3 complex, subunit 3, 21kDa; actin related protein 2/3 complex, subunit 3 (21 kD); actin-related protein 2/3 complex subunit 3; ARC21; p21 Arc; arp2/3 complex 21 kDa subunit; ARP2/3 protein complex subunit p21; p21-Arc;
Gene ID 10094
mRNA Refseq NM_005719
Protein Refseq NP_005710
MIM 604225
UniProt ID O15145

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARPC3 Products

Required fields are marked with *

My Review for All ARPC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon