Recombinant Human ARPC5L protein, GST-tagged
Cat.No. : | ARPC5L-850H |
Product Overview : | Human ARPC5L full-length ORF ( NP_112240.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ARPC5L (Actin Related Protein 2/3 Complex Subunit 5 Like) is a Protein Coding gene. Among its related pathways are Development Slit-Robo signaling and Salmonella infection (KEGG). GO annotations related to this gene include actin binding. An important paralog of this gene is ARPC5. |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARPC5L actin related protein 2/3 complex subunit 5 like [ Homo sapiens (human) ] |
Official Symbol | ARPC5L |
Synonyms | ARPC5L; actin related protein 2/3 complex subunit 5 like; ARC16-2; actin-related protein 2/3 complex subunit 5-like protein; arp2/3 complex 16 kDa subunit 2 |
Gene ID | 81873 |
mRNA Refseq | NM_030978 |
Protein Refseq | NP_112240 |
UniProt ID | Q9BPX5 |
◆ Recombinant Proteins | ||
ARPC5L-1444HF | Recombinant Full Length Human ARPC5L Protein, GST-tagged | +Inquiry |
ARPC5L-800R | Recombinant Rat ARPC5L Protein | +Inquiry |
ARPC5L-1971M | Recombinant Mouse ARPC5L Protein | +Inquiry |
ARPC5L-456R | Recombinant Rat ARPC5L Protein, His (Fc)-Avi-tagged | +Inquiry |
ARPC5L-850H | Recombinant Human ARPC5L protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC5L-128HCL | Recombinant Human ARPC5L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARPC5L Products
Required fields are marked with *
My Review for All ARPC5L Products
Required fields are marked with *