Recombinant Human ARPM2 protein, GST-tagged

Cat.No. : ARPM2-852H
Product Overview : Human ARPM2 partial ORF ( NP_536356, 209 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.75 kDa
AA Sequence : DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACTRT2 actin-related protein T2 [ Homo sapiens ]
Official Symbol ACTRT2
Synonyms ACTRT2; actin-related protein T2; Arp T2; ARPM2; FLJ25424; actin-related protein M2; actin-related protein hArpM2; ARPT2; Arp-T2; HARPM2;
Gene ID 140625
mRNA Refseq NM_080431
Protein Refseq NP_536356
MIM 608535
UniProt ID Q8TDY3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTRT2 Products

Required fields are marked with *

My Review for All ACTRT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon