Recombinant Human ARPM2 protein, GST-tagged
Cat.No. : | ARPM2-852H |
Product Overview : | Human ARPM2 partial ORF ( NP_536356, 209 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.75 kDa |
AA Sequence : | DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACTRT2 actin-related protein T2 [ Homo sapiens ] |
Official Symbol | ACTRT2 |
Synonyms | ACTRT2; actin-related protein T2; Arp T2; ARPM2; FLJ25424; actin-related protein M2; actin-related protein hArpM2; ARPT2; Arp-T2; HARPM2; |
Gene ID | 140625 |
mRNA Refseq | NM_080431 |
Protein Refseq | NP_536356 |
MIM | 608535 |
UniProt ID | Q8TDY3 |
◆ Recombinant Proteins | ||
ACTRT2-244H | Recombinant Human ACTRT2 Protein, GST-tagged | +Inquiry |
ACTRT2-23C | Recombinant Cynomolgus Monkey ACTRT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTRT2-273C | Recombinant Cynomolgus ACTRT2 Protein, His-tagged | +Inquiry |
Actrt2-1521M | Recombinant Mouse Actrt2 Protein, Myc/DDK-tagged | +Inquiry |
ARPM2-852H | Recombinant Human ARPM2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTRT2-9044HCL | Recombinant Human ACTRT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACTRT2 Products
Required fields are marked with *
My Review for All ACTRT2 Products
Required fields are marked with *