Recombinant Human ARPP-19 protein, GST-tagged

Cat.No. : ARPP-19-853H
Product Overview : Human ARPP-19 full-length ORF ( AAH03418, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-112 a.a.
Description : The 19-kD cAMP-regulated phosphoprotein plays a role in regulating mitosis by inhibiting protein phosphatase-2A (PP2A; see MIM 176915) (summary by Gharbi-Ayachi et al., 2010 [PubMed 21164014]).[supplied by OMIM, Feb 2011]
Molecular Mass : 38.06 kDa
AA Sequence : MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARPP19 cAMP-regulated phosphoprotein, 19kDa [ Homo sapiens(human) ]
Official Symbol ARPP19
Synonyms ARPP19; ENSAL; ARPP16; ARPP-16; ARPP-19; cAMP-regulated phosphoprotein, 19kDa; cAMP-regulated phosphoprotein 19; cyclic AMP phosphoprotein, 19 kD
Gene ID 10776
mRNA Refseq NM_006628
Protein Refseq NP_006619
MIM 605487
UniProt ID P56211

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARPP19 Products

Required fields are marked with *

My Review for All ARPP19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon