Recombinant Human ARPP-19 protein, GST-tagged
| Cat.No. : | ARPP-19-853H |
| Product Overview : | Human ARPP-19 full-length ORF ( AAH03418, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-112 a.a. |
| Description : | The 19-kD cAMP-regulated phosphoprotein plays a role in regulating mitosis by inhibiting protein phosphatase-2A (PP2A; see MIM 176915) (summary by Gharbi-Ayachi et al., 2010 [PubMed 21164014]).[supplied by OMIM, Feb 2011] |
| Molecular Mass : | 38.06 kDa |
| AA Sequence : | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARPP19 cAMP-regulated phosphoprotein, 19kDa [ Homo sapiens(human) ] |
| Official Symbol | ARPP19 |
| Synonyms | ARPP19; ENSAL; ARPP16; ARPP-16; ARPP-19; cAMP-regulated phosphoprotein, 19kDa; cAMP-regulated phosphoprotein 19; cyclic AMP phosphoprotein, 19 kD |
| Gene ID | 10776 |
| mRNA Refseq | NM_006628 |
| Protein Refseq | NP_006619 |
| MIM | 605487 |
| UniProt ID | P56211 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARPP19 Products
Required fields are marked with *
My Review for All ARPP19 Products
Required fields are marked with *



