Recombinant Human ARRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARRB1-3765H |
Product Overview : | ARRB1 MS Standard C13 and N15-labeled recombinant protein (NP_064647) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARRB1 arrestin beta 1 [ Homo sapiens (human) ] |
Official Symbol | ARRB1 |
Synonyms | ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2; ARB1; |
Gene ID | 408 |
mRNA Refseq | NM_020251 |
Protein Refseq | NP_064647 |
MIM | 107940 |
UniProt ID | P49407 |
◆ Recombinant Proteins | ||
ARRB1-9892H | Recombinant Human ARRB1, GST-tagged | +Inquiry |
ARRB1-3765H | Recombinant Human ARRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARRB1-026H | Recombinant Human ARRB1 Protein, His-tagged | +Inquiry |
ARRB1-11H | Recombinant Human ARRB1 Protein, N-His-tagged | +Inquiry |
ARRB1-1857M | Recombinant Mouse Arrb1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRB1-8679HCL | Recombinant Human ARRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARRB1 Products
Required fields are marked with *
My Review for All ARRB1 Products
Required fields are marked with *
0
Inquiry Basket