Recombinant Human ARSA
Cat.No. : | ARSA-26265TH |
Product Overview : | Recombinant fragment of Human ARSA with N terminal proprietary tag, 37.73 kDa. Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGE NYNLLGGVAGATPEVQQALKQLQLLKAQLDAAVTFGPSQV ARGEDPALQICCHPGCTPRPACCHCPDPHA |
Sequence Similarities : | Belongs to the sulfatase family. |
Gene Name | ARSA arylsulfatase A [ Homo sapiens ] |
Official Symbol | ARSA |
Synonyms | ARSA; arylsulfatase A; metachromatic leucodystrophy; |
Gene ID | 410 |
mRNA Refseq | NM_000487 |
Protein Refseq | NP_000478 |
MIM | 607574 |
Uniprot ID | P15289 |
Chromosome Location | 22q13.31-qter |
Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem; |
Function | arylsulfatase activity; calcium ion binding; cerebroside-sulfatase activity; hydrolase activity; sulfuric ester hydrolase activity; |
◆ Recombinant Proteins | ||
Arsa-654M | Recombinant Mouse Arsa Protein, MYC/DDK-tagged | +Inquiry |
ARSA-6575H | Recombinant Human ARSA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARSA-2206Z | Recombinant Zebrafish ARSA | +Inquiry |
ARSA-9897H | Recombinant Human ARSA, GST-tagged | +Inquiry |
ARSA-572H | Recombinant Human arylsulfatase A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSA-3086HCL | Recombinant Human ARSA cell lysate | +Inquiry |
ARSA-3085MCL | Recombinant Mouse ARSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARSA Products
Required fields are marked with *
My Review for All ARSA Products
Required fields are marked with *