Recombinant Human ARSJ protein, GST-tagged

Cat.No. : ARSJ-867H
Product Overview : Human ARSJ full-length ORF ( AAH32010.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Sulfatases (EC 3.1.5.6), such as ARSJ, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [PubMed 16174644]).[supplied by OMIM, Mar 2008]
Molecular Mass : 35.2 kDa
AA Sequence : MAPGQQAMGSGTLQSSQPSECSTGNCLQEILATATGSPLSLSATWDRTGGTMNGSPCQLAKVYGFSTSQPTHMRGWTYLTGIQES
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARSJ arylsulfatase family, member J [ Homo sapiens ]
Official Symbol ARSJ
Synonyms ARSJ; arylsulfatase family, member J; ASJ; arylsulfatase J; EC 3.1.6.12
Gene ID 79642
mRNA Refseq NM_024590.3
Protein Refseq NP_078866.3
MIM 610010
UniProt ID Q5FYB0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARSJ Products

Required fields are marked with *

My Review for All ARSJ Products

Required fields are marked with *

0
cart-icon