Recombinant Human ARTN Protein

Cat.No. : ARTN-03H
Product Overview : Recombinant Human ARTN Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Artemin is a neurotrophin member of the glial cell line-derived neurotrophic factor (GDNF) ligand family. Artemin is highly expressed in the adult pituitary gland, placenta, and trachea, and shows low level expression in the brain, spinal cord, and peripheral tissues. Artemin signals through the RET receptor and GDNF family receptor alpha 3 (GFR3) co-receptor complex to support neuronal survival.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer, 12.0/23.9 kDa (113/226 aa)
AA Sequence : AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name ARTN artemin [ Homo sapiens (human) ]
Official Symbol ARTN
Synonyms ARTN; artemin; ENOVIN; EVN; NBN; neublastin; neurotrophic factor;
Gene ID 9048
mRNA Refseq NM_001136215
Protein Refseq NP_001129687
MIM 603886
UniProt ID Q5T4W7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARTN Products

Required fields are marked with *

My Review for All ARTN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon