Recombinant Human ARTN Protein
| Cat.No. : | ARTN-03H | 
| Product Overview : | Recombinant Human ARTN Protein without tag was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Description : | Artemin is a neurotrophin member of the glial cell line-derived neurotrophic factor (GDNF) ligand family. Artemin is highly expressed in the adult pituitary gland, placenta, and trachea, and shows low level expression in the brain, spinal cord, and peripheral tissues. Artemin signals through the RET receptor and GDNF family receptor alpha 3 (GFR3) co-receptor complex to support neuronal survival. | 
| Bio-activity : | No biological activity data is available at this time. | 
| Molecular Mass : | Dimer, 12.0/23.9 kDa (113/226 aa) | 
| AA Sequence : | AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG | 
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL | 
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE | 
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. | 
| Storage : | Storage Prior to Reconstitution: -20 centigrade | 
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) | 
| Reconstitution : | Sterile water at 0.1 mg/mL | 
| Shipping : | Room temperature | 
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. | 
| Gene Name | ARTN artemin [ Homo sapiens (human) ] | 
| Official Symbol | ARTN | 
| Synonyms | ARTN; artemin; ENOVIN; EVN; NBN; neublastin; neurotrophic factor; | 
| Gene ID | 9048 | 
| mRNA Refseq | NM_001136215 | 
| Protein Refseq | NP_001129687 | 
| MIM | 603886 | 
| UniProt ID | Q5T4W7 | 
| ◆ Recombinant Proteins | ||
| ARTN-703H | Recombinant Human ARTN Protein | +Inquiry | 
| ARTN-467R | Recombinant Rat ARTN Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Artn-853M | Recombinant Mouse Artn protein, hFc-tagged | +Inquiry | 
| ARTN-03H | Recombinant Human ARTN Protein | +Inquiry | 
| ARTN-1085HF | Recombinant Full Length Human ARTN Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ARTN-134HCL | Recombinant Human ARTN cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARTN Products
Required fields are marked with *
My Review for All ARTN Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            