Recombinant Human ARX protein, GST-tagged

Cat.No. : ARX-876H
Product Overview : Human ARX partial ORF (NP_620689, 159 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Expansion of a polyalanine tract and other mutations in this gene cause X-linked mental retardation and epilepsy. [provided by RefSeq, Jul 2016]
Molecular Mass : 37.29 kDa
AA Sequence : LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARX aristaless related homeobox [ Homo sapiens ]
Official Symbol ARX
Synonyms ARX; aristaless related homeobox; mental retardation, X linked 29 , mental retardation, X linked 32 , mental retardation, X linked 33 , mental retardation, X linked 36 , mental retardation, X linked 38 , mental retardation, X linked 43 , mental retardation, X linked 54 , mental retardation, X linked 76 , mental retardation, X linked 87 , MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS; homeobox protein ARX; cancer/testis antigen 121; CT121; EIEE1; ISSX; aristaless-related homeobox, X-linked; PRTS; MRX29; MRX32; MRX33; MRX36; MRX38; MRX43; MRX54; MRX76; MRX87; MRXS1;
Gene ID 170302
mRNA Refseq NM_139058
Protein Refseq NP_620689
MIM 300382
UniProt ID Q96QS3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARX Products

Required fields are marked with *

My Review for All ARX Products

Required fields are marked with *

0
cart-icon
0
compare icon