Recombinant Human ASAH1 protein, His-tagged
| Cat.No. : | ASAH1-6754H |
| Product Overview : | Recombinant Human ASAH1 protein(1-389 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-389 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ASAH1 N-acylsphingosine amidohydrolase (acid ceramidase) 1 [ Homo sapiens ] |
| Official Symbol | ASAH1 |
| Synonyms | ASAH1; N-acylsphingosine amidohydrolase (acid ceramidase) 1; ASAH, N acylsphingosine amidohydrolase (acid ceramidase); acid ceramidase; AC; FLJ21558; PHP32; acid CDase; acylsphingosine deacylase; putative 32 kDa heart protein; PHP; ASAH; ACDase; FLJ22079; |
| Gene ID | 427 |
| mRNA Refseq | NM_001127505 |
| Protein Refseq | NP_001120977 |
| MIM | 613468 |
| UniProt ID | Q13510 |
| ◆ Recombinant Proteins | ||
| ASAH1-1134H | Recombinant Human ASAH1 Protein, His-SUMO-tagged | +Inquiry |
| ASAH1-1593C | Recombinant Chicken ASAH1 | +Inquiry |
| ASAH1-814R | Recombinant Rat ASAH1 Protein | +Inquiry |
| ASAH1-9909H | Recombinant Human ASAH1, GST-tagged | +Inquiry |
| ASAH1-3066P | Recombinant Pan troglodytes (Chimpanzee) ASAH1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASAH1 Products
Required fields are marked with *
My Review for All ASAH1 Products
Required fields are marked with *
