Recombinant Human ASAH1 protein, His-tagged
Cat.No. : | ASAH1-6754H |
Product Overview : | Recombinant Human ASAH1 protein(1-389 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-389 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ASAH1 N-acylsphingosine amidohydrolase (acid ceramidase) 1 [ Homo sapiens ] |
Official Symbol | ASAH1 |
Synonyms | ASAH1; N-acylsphingosine amidohydrolase (acid ceramidase) 1; ASAH, N acylsphingosine amidohydrolase (acid ceramidase); acid ceramidase; AC; FLJ21558; PHP32; acid CDase; acylsphingosine deacylase; putative 32 kDa heart protein; PHP; ASAH; ACDase; FLJ22079; |
Gene ID | 427 |
mRNA Refseq | NM_001127505 |
Protein Refseq | NP_001120977 |
MIM | 613468 |
UniProt ID | Q13510 |
◆ Recombinant Proteins | ||
ASAH1-3066P | Recombinant Pan troglodytes (Chimpanzee) ASAH1, His-tagged | +Inquiry |
ASAH1-6469HFL | Recombinant Full Length Human ASAH1 protein, Flag-tagged | +Inquiry |
ASAH1-0471H | Recombinant Human ASAH1 Protein (Gln22-Trp395), N-His-tagged | +Inquiry |
ASAH1-26424TH | Recombinant Human ASAH1 | +Inquiry |
ASAH1-6754H | Recombinant Human ASAH1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ASAH1-13HFL | Recombinant Full Length Human ASAH1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASAH1 Products
Required fields are marked with *
My Review for All ASAH1 Products
Required fields are marked with *