Recombinant Human ASAH2 protein, His-tagged

Cat.No. : ASAH2-115H
Product Overview : Recombinant Human ASAH2 protein(Q9NR71)(610-780aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 610-780aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 25.2 kDa
AA Sequence : FRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name ASAH2 N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2 [ Homo sapiens ]
Official Symbol ASAH2
Synonyms ASAH2; N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2; neutral ceramidase; mitochondrial ceramidase; non-lysosomal ceramidase; acylsphingosine deacylase 2; neutral/alkaline ceramidase; N-acylsphingosine amidohydrolase 2; HNAC1; BCDase; LCDase; NCDase; N-CDase;
Gene ID 56624
mRNA Refseq NM_001143974
Protein Refseq NP_001137446
MIM 611202
UniProt ID Q9NR71

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASAH2 Products

Required fields are marked with *

My Review for All ASAH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon