Recombinant Human ASAH2 protein, His-tagged
Cat.No. : | ASAH2-115H |
Product Overview : | Recombinant Human ASAH2 protein(Q9NR71)(610-780aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 610-780aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.2 kDa |
AA Sequence : | FRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ASAH2 N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2 [ Homo sapiens ] |
Official Symbol | ASAH2 |
Synonyms | ASAH2; N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2; neutral ceramidase; mitochondrial ceramidase; non-lysosomal ceramidase; acylsphingosine deacylase 2; neutral/alkaline ceramidase; N-acylsphingosine amidohydrolase 2; HNAC1; BCDase; LCDase; NCDase; N-CDase; |
Gene ID | 56624 |
mRNA Refseq | NM_001143974 |
Protein Refseq | NP_001137446 |
MIM | 611202 |
UniProt ID | Q9NR71 |
◆ Recombinant Proteins | ||
Asah2-714M | Active Recombinant Mouse Asah2 protein, His-tagged | +Inquiry |
ASAH2-251H | Recombinant Human ASAH2 Protein, His&hFc-tagged | +Inquiry |
ASAH2-365HCL | Recombinant Human ASAH2 Cell Lysate, Myc/DDK-tagged | +Inquiry |
ASAH2-284H | Active Recombinant Human ASAH2, His-tagged | +Inquiry |
ASAH2-815R | Recombinant Rat ASAH2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASAH2-2806MCL | Recombinant Mouse ASAH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASAH2 Products
Required fields are marked with *
My Review for All ASAH2 Products
Required fields are marked with *