Recombinant Human ASB11 Protein, His-tagged

Cat.No. : ASB11-01H
Product Overview : Recombinant human ASB11 protein with His tag was expressed in E. coli.
Availability January 31, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 31.88 kDa
AA Sequence : MNHKVHHHHHHMGNRKEAARIAEEIYGGISDCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ
Purity : >85% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.4 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name ASB11 ankyrin repeat and SOCS box containing 11 [ Homo sapiens (human) ]
Official Symbol ASB11
Synonyms ASB11; ankyrin repeat and SOCS box containing 11; ankyrin repeat and SOCS box protein 11; DKFZp779E2460; ASB-11; ankyrin repeat domain-containing SOCS box protein ASB11; MGC119168; MGC119169
Gene ID 140456
mRNA Refseq NM_001012428
Protein Refseq NP_001012428
MIM 300626
UniProt ID Q8WXH4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASB11 Products

Required fields are marked with *

My Review for All ASB11 Products

Required fields are marked with *

0
cart-icon
0
compare icon