Recombinant Human ASB15 protein, GST-tagged
Cat.No. : | ASB15-887H |
Product Overview : | Human ASB15 full-length ORF ( AAI66689.1, 1 a.a. - 588 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the suppressor of cytokine signaling box superfamily. The proteins in this superfamily participate in the ubiquitin-proteasome system for the degradation of proteins in the cell cycle and signal transduction pathways. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 64.7 kDa |
AA Sequence : | MDTNDDPDEDHLTSYDIQLSIQESIEASKTALCPERFVPLSAQNRKLVEAIKQGHIPELQEYVKYKYAMDEADEKGWFPLHEAVVQPIQQILEIVLDASYKTLWEFKTCDGETPLTLAVKAGLVENVRTLLEKGVWPNTKNDKGETPLLIAVKKGSYDMVSTLIKHNTSLDQPCVKRWSAMHEAAKQGRKDIVALLLKHGGNVHLRDGFGVTPLGVAAEYGHCDVLEHLIHKGGDVLALADDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHLPIHRAAYEGHYLALKYLIPVTSKNAIRKSGLTPIHSAADGQNAQCLELLIENGFDVNTLLADHISQSYDDERKTALYFGVSNNDVHCTEVLLAAGADPNLDPLNCLLVAVRANNYEIVRLLLSHGANVNCYFMHVNDTRFPSVIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSEIQEEVLPGWTSCVIKDNPFCEFITVPWMKHLVGRVTRVLIDYMDYVPLCAKLKSALEVQREWPEIRQILENPCSLKHLCRLKIRRLMGLQKLCQPASVEKLPLPPAIQRYILFKEYDLYGQELKLT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASB15 ankyrin repeat and SOCS box containing 15 [ Homo sapiens ] |
Official Symbol | ASB15 |
Synonyms | ASB15; ankyrin repeat and SOCS box containing 15; ankyrin repeat and SOCS box protein 15; FLJ43370; ASB-15; ankyrin repeat and SOCS box-containing 15; DKFZp779M1258; |
Gene ID | 142685 |
mRNA Refseq | NM_080928 |
Protein Refseq | NP_563616 |
UniProt ID | Q8WXK1 |
◆ Recombinant Proteins | ||
ASB15-887H | Recombinant Human ASB15 protein, GST-tagged | +Inquiry |
ASB15-1373HF | Recombinant Full Length Human ASB15 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASB15 Products
Required fields are marked with *
My Review for All ASB15 Products
Required fields are marked with *
0
Inquiry Basket