Recombinant Human ASB18 protein, GST-tagged

• Cat.No.: ASB18-890H
• Product Overview: Human ASB18 full-length ORF (BAC85710.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ASB18 (Ankyrin Repeat And SOCS Box Containing 18) is a Protein Coding gene. Among its related pathways are Immune System and Class I MHC mediated antigen processing and presentation. An important paralog of this gene is ASB10.
• Molecular Mass: 47.3 kDa
• AA Sequence: MERQPGPVRGKLQIFQKTEKDPQARAGSPVQEYHTALVAGDLDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSGLWTLEYKRELTTPLCIAAAHGHTACVRHLLGRGADPDASPAGPRVPDRILRSPGLTAAHGAGAAQPRLSHRVARRLPQGAEDLCICPRSHRGAFQLLPSALLVRVLEGSDS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASB18 ankyrin repeat and SOCS box containing 18 [ Homo sapiens (human) ]
• Official Symbol: ASB18
• Synonyms: ASB18; ankyrin repeat and SOCS box containing 18; ASB-18; ankyrin repeat and SOCS box protein 18
• Gene ID: 401036
• mRNA Refseq: NM_212556
• Protein Refseq: NP_997721
• UniProt ID: Q6ZVZ8