Recombinant Human ASB18 protein, GST-tagged

Cat.No. : ASB18-890H
Product Overview : Human ASB18 full-length ORF (BAC85710.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ASB18 (Ankyrin Repeat And SOCS Box Containing 18) is a Protein Coding gene. Among its related pathways are Immune System and Class I MHC mediated antigen processing and presentation. An important paralog of this gene is ASB10.
Molecular Mass : 47.3 kDa
AA Sequence : MERQPGPVRGKLQIFQKTEKDPQARAGSPVQEYHTALVAGDLDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSGLWTLEYKRELTTPLCIAAAHGHTACVRHLLGRGADPDASPAGPRVPDRILRSPGLTAAHGAGAAQPRLSHRVARRLPQGAEDLCICPRSHRGAFQLLPSALLVRVLEGSDS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASB18 ankyrin repeat and SOCS box containing 18 [ Homo sapiens (human) ]
Official Symbol ASB18
Synonyms ASB18; ankyrin repeat and SOCS box containing 18; ASB-18; ankyrin repeat and SOCS box protein 18
Gene ID 401036
mRNA Refseq NM_212556
Protein Refseq NP_997721
UniProt ID Q6ZVZ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASB18 Products

Required fields are marked with *

My Review for All ASB18 Products

Required fields are marked with *

0
cart-icon