Recombinant Human ASB18 protein, GST-tagged
Cat.No. : | ASB18-890H |
Product Overview : | Human ASB18 full-length ORF (BAC85710.1, 1 a.a. - 192 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ASB18 (Ankyrin Repeat And SOCS Box Containing 18) is a Protein Coding gene. Among its related pathways are Immune System and Class I MHC mediated antigen processing and presentation. An important paralog of this gene is ASB10. |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MERQPGPVRGKLQIFQKTEKDPQARAGSPVQEYHTALVAGDLDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSGLWTLEYKRELTTPLCIAAAHGHTACVRHLLGRGADPDASPAGPRVPDRILRSPGLTAAHGAGAAQPRLSHRVARRLPQGAEDLCICPRSHRGAFQLLPSALLVRVLEGSDS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASB18 ankyrin repeat and SOCS box containing 18 [ Homo sapiens (human) ] |
Official Symbol | ASB18 |
Synonyms | ASB18; ankyrin repeat and SOCS box containing 18; ASB-18; ankyrin repeat and SOCS box protein 18 |
Gene ID | 401036 |
mRNA Refseq | NM_212556 |
Protein Refseq | NP_997721 |
UniProt ID | Q6ZVZ8 |
◆ Recombinant Proteins | ||
ASB18-776M | Recombinant Mouse ASB18 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASB18-890H | Recombinant Human ASB18 protein, GST-tagged | +Inquiry |
ASB18-2013M | Recombinant Mouse ASB18 Protein | +Inquiry |
ASB18-1316HF | Recombinant Full Length Human ASB18 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASB18 Products
Required fields are marked with *
My Review for All ASB18 Products
Required fields are marked with *