Recombinant Human ASCL3 protein, GST-tagged
Cat.No. : | ASCL3-902H |
Product Overview : | Human ASCL3 full-length ORF ( NP_065697.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASCL3 achaete-scute complex homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | ASCL3 |
Synonyms | ASCL3; achaete-scute complex homolog 3 (Drosophila); achaete scute complex (Drosophila) homolog like 3; achaete-scute homolog 3; bHLHa42; HASH3; Sgn1; ASH-3; bHLH transcriptional regulator Sgn-1; class A basic helix-loop-helix protein 42; bHLH transcription factor Sgn-1 (Salivary Glands 1); SGN1; |
Gene ID | 56676 |
mRNA Refseq | NM_020646 |
Protein Refseq | NP_065697 |
MIM | 609154 |
UniProt ID | Q9NQ33 |
◆ Recombinant Proteins | ||
ASCL3-2027M | Recombinant Mouse ASCL3 Protein | +Inquiry |
ASCL3-786M | Recombinant Mouse ASCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASCL3-3306H | Recombinant Human ASCL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ascl3-1741M | Recombinant Mouse Ascl3 Protein, Myc/DDK-tagged | +Inquiry |
ASCL3-902H | Recombinant Human ASCL3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASCL3 Products
Required fields are marked with *
My Review for All ASCL3 Products
Required fields are marked with *