Recombinant Human ASCL3 protein, GST-tagged

Cat.No. : ASCL3-902H
Product Overview : Human ASCL3 full-length ORF ( NP_065697.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]
Molecular Mass : 47.3 kDa
AA Sequence : MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASCL3 achaete-scute complex homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol ASCL3
Synonyms ASCL3; achaete-scute complex homolog 3 (Drosophila); achaete scute complex (Drosophila) homolog like 3; achaete-scute homolog 3; bHLHa42; HASH3; Sgn1; ASH-3; bHLH transcriptional regulator Sgn-1; class A basic helix-loop-helix protein 42; bHLH transcription factor Sgn-1 (Salivary Glands 1); SGN1;
Gene ID 56676
mRNA Refseq NM_020646
Protein Refseq NP_065697
MIM 609154
UniProt ID Q9NQ33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASCL3 Products

Required fields are marked with *

My Review for All ASCL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon