Recombinant Human ASGR1 protein(71-150 aa), C-hFc & C-His-tagged

Cat.No. : ASGR1-2580H
Product Overview : Recombinant Human ASGR1 protein(P07306)(71-150 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : 71-150 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSE
Gene Name ASGR1 asialoglycoprotein receptor 1 [ Homo sapiens ]
Official Symbol ASGR1
Synonyms ASGR1; asialoglycoprotein receptor 1; CLEC4H1; hepatic lectin H1; C-type lectin domain family 4 member H1; HL-1; ASGPR; ASGPR1;
Gene ID 432
mRNA Refseq NM_001197216
Protein Refseq NP_001184145
MIM 108360
UniProt ID P07306

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASGR1 Products

Required fields are marked with *

My Review for All ASGR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon