Recombinant Human ASGR1 protein(71-150 aa), C-hFc & C-His-tagged
Cat.No. : | ASGR1-2580H |
Product Overview : | Recombinant Human ASGR1 protein(P07306)(71-150 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 71-150 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSE |
Gene Name | ASGR1 asialoglycoprotein receptor 1 [ Homo sapiens ] |
Official Symbol | ASGR1 |
Synonyms | ASGR1; asialoglycoprotein receptor 1; CLEC4H1; hepatic lectin H1; C-type lectin domain family 4 member H1; HL-1; ASGPR; ASGPR1; |
Gene ID | 432 |
mRNA Refseq | NM_001197216 |
Protein Refseq | NP_001184145 |
MIM | 108360 |
UniProt ID | P07306 |
◆ Recombinant Proteins | ||
Asgr1-656M | Recombinant Mouse Asgr1 Protein, MYC/DDK-tagged | +Inquiry |
ASGR1-588H | Recombinant Human ASGR1, GST-tagged | +Inquiry |
ASGR1-251H | Active Recombinant Human ASGR1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
ASGR1-0378H | Recombinant Human ASGR1 Protein (Gln62-Ile291), C-His-tagged | +Inquiry |
Asgr1-2556M | Recombinant Mouse Asgr1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASGR1-1601HCL | Recombinant Human ASGR1 cell lysate | +Inquiry |
ASGR1-3084MCL | Recombinant Mouse ASGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASGR1 Products
Required fields are marked with *
My Review for All ASGR1 Products
Required fields are marked with *