Recombinant Human ASK protein, GST-tagged
| Cat.No. : | ASK-908H |
| Product Overview : | Human ASK partial ORF ( NP_006707, 2 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DBF4 (DBF4 Zinc Finger) is a Protein Coding gene. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Mitotic G1-G1/S phases. GO annotations related to this gene include nucleic acid binding and enzyme activator activity. An important paralog of this gene is DBF4B. |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DBF4 DBF4 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | DBF4 |
| Synonyms | DBF4; DBF4 homolog (S. cerevisiae); protein DBF4 homolog A; activator of S phase kinase; ASK; chif; chiffon homolog (Drosophila); DBF4A; ZDBF1; zinc finger; DBF type containing 1; chiffon homolog A; zinc finger, DBF-type containing 1; DBF4-type zinc finger-containing protein 1; CHIF; |
| Gene ID | 10926 |
| mRNA Refseq | NM_006716 |
| Protein Refseq | NP_006707 |
| MIM | 604281 |
| UniProt ID | Q9UBU7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBF4 Products
Required fields are marked with *
My Review for All DBF4 Products
Required fields are marked with *
