Recombinant Human ASK protein, GST-tagged
Cat.No. : | ASK-908H |
Product Overview : | Human ASK partial ORF ( NP_006707, 2 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DBF4 (DBF4 Zinc Finger) is a Protein Coding gene. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Mitotic G1-G1/S phases. GO annotations related to this gene include nucleic acid binding and enzyme activator activity. An important paralog of this gene is DBF4B. |
Molecular Mass : | 36.41 kDa |
AA Sequence : | NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DBF4 DBF4 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | DBF4 |
Synonyms | DBF4; DBF4 homolog (S. cerevisiae); protein DBF4 homolog A; activator of S phase kinase; ASK; chif; chiffon homolog (Drosophila); DBF4A; ZDBF1; zinc finger; DBF type containing 1; chiffon homolog A; zinc finger, DBF-type containing 1; DBF4-type zinc finger-containing protein 1; CHIF; |
Gene ID | 10926 |
mRNA Refseq | NM_006716 |
Protein Refseq | NP_006707 |
MIM | 604281 |
UniProt ID | Q9UBU7 |
◆ Recombinant Proteins | ||
DBF4-2777H | Recombinant Human DBF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DBF4-689H | Recombinant Human DBF4 | +Inquiry |
DBF4-6842H | Recombinant Human DBF4 protein, His-tagged | +Inquiry |
DBF4-7188Z | Recombinant Zebrafish DBF4 | +Inquiry |
ASK-908H | Recombinant Human ASK protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBF4-7067HCL | Recombinant Human DBF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBF4 Products
Required fields are marked with *
My Review for All DBF4 Products
Required fields are marked with *