Recombinant Human ASK protein, GST-tagged

Cat.No. : ASK-908H
Product Overview : Human ASK partial ORF ( NP_006707, 2 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DBF4 (DBF4 Zinc Finger) is a Protein Coding gene. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Mitotic G1-G1/S phases. GO annotations related to this gene include nucleic acid binding and enzyme activator activity. An important paralog of this gene is DBF4B.
Molecular Mass : 36.41 kDa
AA Sequence : NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DBF4 DBF4 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol DBF4
Synonyms DBF4; DBF4 homolog (S. cerevisiae); protein DBF4 homolog A; activator of S phase kinase; ASK; chif; chiffon homolog (Drosophila); DBF4A; ZDBF1; zinc finger; DBF type containing 1; chiffon homolog A; zinc finger, DBF-type containing 1; DBF4-type zinc finger-containing protein 1; CHIF;
Gene ID 10926
mRNA Refseq NM_006716
Protein Refseq NP_006707
MIM 604281
UniProt ID Q9UBU7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DBF4 Products

Required fields are marked with *

My Review for All DBF4 Products

Required fields are marked with *

0
cart-icon