Recombinant Human ASMT protein, GST-tagged
| Cat.No. : | ASMT-911H |
| Product Overview : | Human ASMT partial ORF ( NP_004034, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to the methyltransferase superfamily, and is located in the pseudoautosomal region (PAR) at the end of the short arms of the X and Y chromosomes. The encoded enzyme catalyzes the final reaction in the synthesis of melatonin, and is abundant in the pineal gland. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2010] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ASMT acetylserotonin O-methyltransferase [ Homo sapiens ] |
| Official Symbol | ASMT |
| Synonyms | ASMT; acetylserotonin O-methyltransferase; ASMTY; HIOMT; HIOMTY; hydroxyindole O-methyltransferase; acetylserotonin N-methyltransferase; acetylserotonin methyltransferase (Y chromosome); |
| Gene ID | 438 |
| mRNA Refseq | NM_001171038 |
| Protein Refseq | NP_001164509 |
| MIM | 300015 |
| UniProt ID | P46597 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASMT Products
Required fields are marked with *
My Review for All ASMT Products
Required fields are marked with *
