Recombinant Human ASMT protein, GST-tagged
Cat.No. : | ASMT-911H |
Product Overview : | Human ASMT partial ORF ( NP_004034, 71 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the methyltransferase superfamily, and is located in the pseudoautosomal region (PAR) at the end of the short arms of the X and Y chromosomes. The encoded enzyme catalyzes the final reaction in the synthesis of melatonin, and is abundant in the pineal gland. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASMT acetylserotonin O-methyltransferase [ Homo sapiens ] |
Official Symbol | ASMT |
Synonyms | ASMT; acetylserotonin O-methyltransferase; ASMTY; HIOMT; HIOMTY; hydroxyindole O-methyltransferase; acetylserotonin N-methyltransferase; acetylserotonin methyltransferase (Y chromosome); |
Gene ID | 438 |
mRNA Refseq | NM_001171038 |
Protein Refseq | NP_001164509 |
MIM | 300015 |
UniProt ID | P46597 |
◆ Recombinant Proteins | ||
ASMT-827R | Recombinant Rat ASMT Protein | +Inquiry |
ASMT-1023HF | Recombinant Full Length Human ASMT Protein, GST-tagged | +Inquiry |
ASMT-428R | Recombinant Rhesus monkey ASMT Protein, His-tagged | +Inquiry |
ASMT-911H | Recombinant Human ASMT protein, GST-tagged | +Inquiry |
ASMT-6895C | Recombinant Chicken ASMT | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASMT-41HCL | Recombinant Human ASMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASMT Products
Required fields are marked with *
My Review for All ASMT Products
Required fields are marked with *