Recombinant Human ASPH protein, GST-tagged
Cat.No. : | ASPH-917H |
Product Overview : | Human ASPH full-length ORF ( NP_115856.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASPH aspartate beta-hydroxylase [ Homo sapiens ] |
Official Symbol | ASPH |
Synonyms | ASPH; aspartate beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; BAH; CASQ2BP1; HAAH; humbug; JCTN; junctate; junctin; A beta H-J-J; cardiac junctin; ASP beta-hydroxylase; peptide-aspartate beta-dioxygenase; aspartyl/asparaginyl-beta-hydroxylase; AAH; |
Gene ID | 444 |
mRNA Refseq | NM_001164750 |
Protein Refseq | NP_001158222 |
MIM | 600582 |
UniProt ID | Q12797 |
◆ Recombinant Proteins | ||
ASPH-2896H | Recombinant Human ASPH protein, His-tagged | +Inquiry |
ASPH-6093H | Recombinant Human ASPH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ASPH-9940H | Recombinant Human ASPH, GST-tagged | +Inquiry |
ASPH-1057HF | Recombinant Full Length Human ASPH Protein, GST-tagged | +Inquiry |
ASPH-4503H | Recombinant Human ASPH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASPH-8645HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
ASPH-8644HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
ASPH-8643HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASPH Products
Required fields are marked with *
My Review for All ASPH Products
Required fields are marked with *
0
Inquiry Basket