Recombinant Human ASPH protein, GST-tagged

Cat.No. : ASPH-917H
Product Overview : Human ASPH full-length ORF ( NP_115856.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Molecular Mass : 50.2 kDa
AA Sequence : MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASPH aspartate beta-hydroxylase [ Homo sapiens ]
Official Symbol ASPH
Synonyms ASPH; aspartate beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; BAH; CASQ2BP1; HAAH; humbug; JCTN; junctate; junctin; A beta H-J-J; cardiac junctin; ASP beta-hydroxylase; peptide-aspartate beta-dioxygenase; aspartyl/asparaginyl-beta-hydroxylase; AAH;
Gene ID 444
mRNA Refseq NM_001164750
Protein Refseq NP_001158222
MIM 600582
UniProt ID Q12797

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASPH Products

Required fields are marked with *

My Review for All ASPH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon