Recombinant Human ASPH protein, His-SUMO-tagged
| Cat.No. : | ASPH-2561H | 
| Product Overview : | Recombinant Human ASPH protein(Q12797)(75-270aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 75-270aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 38.2 kDa | 
| AA Sequence : | FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | ASPH aspartate beta-hydroxylase [ Homo sapiens ] | 
| Official Symbol | ASPH | 
| Synonyms | ASPH; aspartate beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; BAH; CASQ2BP1; HAAH; humbug; JCTN; junctate; junctin; A beta H-J-J; cardiac junctin; ASP beta-hydroxylase; peptide-aspartate beta-dioxygenase; aspartyl/asparaginyl-beta-hydroxylase; AAH; | 
| Gene ID | 444 | 
| mRNA Refseq | NM_001164750 | 
| Protein Refseq | NP_001158222 | 
| MIM | 600582 | 
| UniProt ID | Q12797 | 
| ◆ Recombinant Proteins | ||
| ASPH-396H | Recombinant Human ASPH Protein, His-tagged | +Inquiry | 
| ASPH-1057HF | Recombinant Full Length Human ASPH Protein, GST-tagged | +Inquiry | 
| ASPH-917H | Recombinant Human ASPH protein, GST-tagged | +Inquiry | 
| ASPH-2896H | Recombinant Human ASPH protein, His-tagged | +Inquiry | 
| ASPH-254H | Recombinant Human ASPH Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ASPH-8643HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry | 
| ASPH-8645HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry | 
| ASPH-8644HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASPH Products
Required fields are marked with *
My Review for All ASPH Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            