Recombinant Human ASPH protein, His-SUMO-tagged

Cat.No. : ASPH-2561H
Product Overview : Recombinant Human ASPH protein(Q12797)(75-270aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 75-270aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.2 kDa
AA Sequence : FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ASPH aspartate beta-hydroxylase [ Homo sapiens ]
Official Symbol ASPH
Synonyms ASPH; aspartate beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; BAH; CASQ2BP1; HAAH; humbug; JCTN; junctate; junctin; A beta H-J-J; cardiac junctin; ASP beta-hydroxylase; peptide-aspartate beta-dioxygenase; aspartyl/asparaginyl-beta-hydroxylase; AAH;
Gene ID 444
mRNA Refseq NM_001164750
Protein Refseq NP_001158222
MIM 600582
UniProt ID Q12797

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASPH Products

Required fields are marked with *

My Review for All ASPH Products

Required fields are marked with *

0
cart-icon
0
compare icon