Recombinant Human ASPH protein, His-SUMO-tagged
Cat.No. : | ASPH-2561H |
Product Overview : | Recombinant Human ASPH protein(Q12797)(75-270aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 75-270aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.2 kDa |
AA Sequence : | FDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPDT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ASPH aspartate beta-hydroxylase [ Homo sapiens ] |
Official Symbol | ASPH |
Synonyms | ASPH; aspartate beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; BAH; CASQ2BP1; HAAH; humbug; JCTN; junctate; junctin; A beta H-J-J; cardiac junctin; ASP beta-hydroxylase; peptide-aspartate beta-dioxygenase; aspartyl/asparaginyl-beta-hydroxylase; AAH; |
Gene ID | 444 |
mRNA Refseq | NM_001164750 |
Protein Refseq | NP_001158222 |
MIM | 600582 |
UniProt ID | Q12797 |
◆ Recombinant Proteins | ||
ASPH-6093H | Recombinant Human ASPH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Asph-1749M | Recombinant Mouse Asph Protein, Myc/DDK-tagged | +Inquiry |
ASPH-0413H | Recombinant Human ASPH Protein (Asp101-Thr270), N-His-tagged | +Inquiry |
ASPH-393H | Recombinant Human ASPH Protein, His (Fc)-Avi-tagged | +Inquiry |
ASPH-1940H | Recombinant Human Aspartate beta-hydroxylase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASPH-8644HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
ASPH-8643HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
ASPH-8645HCL | Recombinant Human ASPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASPH Products
Required fields are marked with *
My Review for All ASPH Products
Required fields are marked with *
0
Inquiry Basket