Recombinant Human ASTN2 protein, GST-tagged
Cat.No. : | ASTN2-924H |
Product Overview : | Human ASTN2 full-length ORF ( AAH29272.1, 1 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is expressed in the brain and may function in neuronal migration, based on functional studies of the related astrotactin 1 gene in human and mouse. A deletion at this locus has been associated with schizophrenia. Multiple transcript variants encoding different proteins have been found for this locus. [provided by RefSeq, May 2010] |
Molecular Mass : | 76 kDa |
AA Sequence : | MNTLLCKGMFCLLSWEADSRGRLGEYTLQPLSLQTEETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCDLSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGEFLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTACPLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGPRKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKIMCEEKMVSMARNTYGESKGR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASTN2 astrotactin 2 [ Homo sapiens ] |
Official Symbol | ASTN2 |
Synonyms | ASTN2; astrotactin 2; astrotactin-2; KIAA0634; bA264C15.1; bA67K19.1; |
Gene ID | 23245 |
mRNA Refseq | NM_001184734 |
Protein Refseq | NP_001171663 |
MIM | 612856 |
UniProt ID | O75129 |
◆ Recombinant Proteins | ||
ASTN2-9950H | Recombinant Human ASTN2, GST-tagged | +Inquiry |
ASTN2-1202HF | Recombinant Full Length Human ASTN2 Protein, GST-tagged | +Inquiry |
ASTN2-924H | Recombinant Human ASTN2 protein, GST-tagged | +Inquiry |
ASTN2-3675H | Recombinant Human ASTN2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASTN2-141HCL | Recombinant Human ASTN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASTN2 Products
Required fields are marked with *
My Review for All ASTN2 Products
Required fields are marked with *
0
Inquiry Basket