Recombinant Human ASZ1 protein, GST-tagged
| Cat.No. : | ASZ1-9953H |
| Product Overview : | Recombinant Human ASZ1 protein(20-372 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | September 26, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 20-372 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | SEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFLLKLNKQCGHLIT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ASZ1 ankyrin repeat, SAM and basic leucine zipper domain containing 1 [ Homo sapiens ] |
| Official Symbol | ASZ1 |
| Synonyms | ASZ1; ankyrin repeat, SAM and basic leucine zipper domain containing 1; ANKL1, ankyrin like 1 , C7orf7; ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1; ALP1; CT1.19; GASZ; Orf3; 4933400N19Rik; ankyrin-like 1; ankyrin-like protein 1; germ cell-specific ankyrin, SAM and basic leucine zipper domain-containing protein; ANKL1; C7orf7; MGC26634; |
| Gene ID | 136991 |
| mRNA Refseq | NM_130768 |
| Protein Refseq | NP_570124 |
| MIM | 605797 |
| UniProt ID | Q8WWH4 |
| ◆ Recombinant Proteins | ||
| Asz1-1756M | Recombinant Mouse Asz1 Protein, Myc/DDK-tagged | +Inquiry |
| ASZ1-927H | Recombinant Human ASZ1 protein, GST-tagged | +Inquiry |
| ASZ1-9953H | Recombinant Human ASZ1 protein, GST-tagged | +Inquiry |
| ASZ1-10570Z | Recombinant Zebrafish ASZ1 | +Inquiry |
| ASZ1-2378H | Recombinant Human ASZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASZ1-8637HCL | Recombinant Human ASZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASZ1 Products
Required fields are marked with *
My Review for All ASZ1 Products
Required fields are marked with *
