Recombinant Human ASZ1 protein, GST-tagged

Cat.No. : ASZ1-9953H
Product Overview : Recombinant Human ASZ1 protein(20-372 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability September 01, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 20-372 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : SEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFLLKLNKQCGHLIT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name ASZ1 ankyrin repeat, SAM and basic leucine zipper domain containing 1 [ Homo sapiens ]
Official Symbol ASZ1
Synonyms ASZ1; ankyrin repeat, SAM and basic leucine zipper domain containing 1; ANKL1, ankyrin like 1 , C7orf7; ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1; ALP1; CT1.19; GASZ; Orf3; 4933400N19Rik; ankyrin-like 1; ankyrin-like protein 1; germ cell-specific ankyrin, SAM and basic leucine zipper domain-containing protein; ANKL1; C7orf7; MGC26634;
Gene ID 136991
mRNA Refseq NM_130768
Protein Refseq NP_570124
MIM 605797
UniProt ID Q8WWH4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASZ1 Products

Required fields are marked with *

My Review for All ASZ1 Products

Required fields are marked with *

0
cart-icon
0
compare icon