Recombinant Human ASZ1 protein, GST-tagged

• Cat.No.: ASZ1-9953H
• Product Overview: Recombinant Human ASZ1 protein(20-372 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 20-372 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: SEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGISVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFLLKLNKQCGHLIT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ASZ1 ankyrin repeat, SAM and basic leucine zipper domain containing 1 [ Homo sapiens ]
• Official Symbol: ASZ1
• Synonyms: ASZ1; ankyrin repeat, SAM and basic leucine zipper domain containing 1; ANKL1, ankyrin like 1 , C7orf7; ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1; ALP1; CT1.19; GASZ; Orf3; 4933400N19Rik; ankyrin-like 1; ankyrin-like protein 1; germ cell-specific ankyrin, SAM and basic leucine zipper domain-containing protein; ANKL1; C7orf7; MGC26634
• Gene ID: 136991
• mRNA Refseq: NM_130768
• Protein Refseq: NP_570124
• MIM: 605797
• UniProt ID: Q8WWH4