Recombinant Human ATAD4 protein, GST-tagged
Cat.No. : | ATAD4-933H |
Product Overview : | Human ATAD4 full-length ORF ( NP_077296.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PRR15L (Proline Rich 15 Like) is a Protein Coding gene. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PRR15L proline rich 15-like [ Homo sapiens ] |
Official Symbol | PRR15L |
Synonyms | ATAD4 |
Gene ID | 79170 |
mRNA Refseq | NM_024320.3 |
Protein Refseq | NP_077296.1 |
UniProt ID | Q9BU68 |
◆ Recombinant Proteins | ||
PRR15L-1300HF | Recombinant Full Length Human PRR15L Protein, GST-tagged | +Inquiry |
Prr15l-5157M | Recombinant Mouse Prr15l Protein, Myc/DDK-tagged | +Inquiry |
PRR15L-13470M | Recombinant Mouse PRR15L Protein | +Inquiry |
PRR15L-7154M | Recombinant Mouse PRR15L Protein, His (Fc)-Avi-tagged | +Inquiry |
ATAD4-933H | Recombinant Human ATAD4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRR15L-2813HCL | Recombinant Human PRR15L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRR15L Products
Required fields are marked with *
My Review for All PRR15L Products
Required fields are marked with *
0
Inquiry Basket