Recombinant Human ATCAY protein, GST-tagged

Cat.No. : ATCAY-934H
Product Overview : Human ATCAY partial ORF ( NP_149053.1, 3 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. [provided by RefSeq, Jul 2008]
Molecular Mass : 33 kDa
AA Sequence : TTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATCAY ataxia, cerebellar, Cayman type [ Homo sapiens ]
Official Symbol ATCAY
Synonyms ATCAY; ataxia, cerebellar, Cayman type; caytaxin; Cayman ataxia; ataxia cayman type protein; CLAC; BNIP-H; KIAA1872;
Gene ID 85300
mRNA Refseq NM_033064
Protein Refseq NP_149053
MIM 608179
UniProt ID Q86WG3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATCAY Products

Required fields are marked with *

My Review for All ATCAY Products

Required fields are marked with *

0
cart-icon