Recombinant Human ATCAY protein, GST-tagged
Cat.No. : | ATCAY-934H |
Product Overview : | Human ATCAY partial ORF ( NP_149053.1, 3 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 33 kDa |
AA Sequence : | TTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATCAY ataxia, cerebellar, Cayman type [ Homo sapiens ] |
Official Symbol | ATCAY |
Synonyms | ATCAY; ataxia, cerebellar, Cayman type; caytaxin; Cayman ataxia; ataxia cayman type protein; CLAC; BNIP-H; KIAA1872; |
Gene ID | 85300 |
mRNA Refseq | NM_033064 |
Protein Refseq | NP_149053 |
MIM | 608179 |
UniProt ID | Q86WG3 |
◆ Recombinant Proteins | ||
ATCAY-2062M | Recombinant Mouse ATCAY Protein | +Inquiry |
ATCAY-837R | Recombinant Rat ATCAY Protein | +Inquiry |
ATCAY-395H | Recombinant Human ATCAY Protein, His (Fc)-Avi-tagged | +Inquiry |
ATCAY-934H | Recombinant Human ATCAY protein, GST-tagged | +Inquiry |
Atcay-1250M | Recombinant Mouse Atcay Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATCAY Products
Required fields are marked with *
My Review for All ATCAY Products
Required fields are marked with *