Recombinant Human ATF4, His-tagged

• Cat.No.: ATF4-27048TH
• Product Overview: Recombinant fragment, corresponding to amino acids 123-351 of Human ATF4 with an N terminal His tag; Predicted MWt 26 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 123-351 a.a.
• Description: This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 155 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQP LPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAY VAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPST RGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGE KLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKK NEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
• Sequence Similarities: Belongs to the bZIP family.Contains 1 bZIP domain.

Gene Information

• Gene Name: ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Homo sapiens ]
• Official Symbol: ATF4
• Synonyms: ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); TXREB; cyclic AMP-dependent transcription factor ATF-4; CREB 2; TAXREB67
• Gene ID: 468
• mRNA Refseq: NM_001675
• Protein Refseq: NP_001666
• MIM: 604064
• Uniprot ID: P18848
• Chromosome Location: 22q13.1
• Pathway: Cholinergic synapse, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; GnRH signaling pathway, organism-specific biosystem
• Function: DNA binding; DNA binding; protein binding; protein dimerization activity; sequence-specific DNA binding