Recombinant Human ATF4, His-tagged

Cat.No. : ATF4-27048TH
Product Overview : Recombinant fragment, corresponding to amino acids 123-351 of Human ATF4 with an N terminal His tag; Predicted MWt 26 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 123-351 a.a.
Description : This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 155 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQP LPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAY VAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPST RGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGE KLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKK NEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Sequence Similarities : Belongs to the bZIP family.Contains 1 bZIP domain.
Gene Name ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Homo sapiens ]
Official Symbol ATF4
Synonyms ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); TXREB; cyclic AMP-dependent transcription factor ATF-4; CREB 2; TAXREB67;
Gene ID 468
mRNA Refseq NM_001675
Protein Refseq NP_001666
MIM 604064
Uniprot ID P18848
Chromosome Location 22q13.1
Pathway Cholinergic synapse, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; GnRH signaling pathway, organism-specific biosystem;
Function DNA binding; DNA binding; protein binding; protein dimerization activity; sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATF4 Products

Required fields are marked with *

My Review for All ATF4 Products

Required fields are marked with *

0
cart-icon