Recombinant Human ATF4, His-tagged
| Cat.No. : | ATF4-27048TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 123-351 of Human ATF4 with an N terminal His tag; Predicted MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 123-351 a.a. |
| Description : | This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 155 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQP LPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAY VAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPST RGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGE KLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKK NEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP |
| Sequence Similarities : | Belongs to the bZIP family.Contains 1 bZIP domain. |
| Gene Name | ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Homo sapiens ] |
| Official Symbol | ATF4 |
| Synonyms | ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); TXREB; cyclic AMP-dependent transcription factor ATF-4; CREB 2; TAXREB67; |
| Gene ID | 468 |
| mRNA Refseq | NM_001675 |
| Protein Refseq | NP_001666 |
| MIM | 604064 |
| Uniprot ID | P18848 |
| Chromosome Location | 22q13.1 |
| Pathway | Cholinergic synapse, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; GnRH signaling pathway, organism-specific biosystem; |
| Function | DNA binding; DNA binding; protein binding; protein dimerization activity; sequence-specific DNA binding; |
| ◆ Recombinant Proteins | ||
| ATF4-1074HF | Recombinant Full Length Human ATF4 Protein, GST-tagged | +Inquiry |
| Atf4-6892R | Recombinant Rat Atf4 protein, His & T7-tagged | +Inquiry |
| Atf4-6891M | Recombinant Mouse Atf4 protein, His & T7-tagged | +Inquiry |
| ATF4-7942H | Recombinant Human ATF4 protein, GST-tagged | +Inquiry |
| ATF4-0291H | Recombinant Human ATF4 Protein (Met1-Pro351), N-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATF4 Products
Required fields are marked with *
My Review for All ATF4 Products
Required fields are marked with *
