Recombinant Human ATF4, His-tagged
Cat.No. : | ATF4-27048TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 123-351 of Human ATF4 with an N terminal His tag; Predicted MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 155 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQP LPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAY VAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPST RGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGE KLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKK NEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP |
Sequence Similarities : | Belongs to the bZIP family.Contains 1 bZIP domain. |
Gene Name : | ATF4 activating transcription factor 4 (tax-responsive enhancer element B67) [ Homo sapiens ] |
Official Symbol : | ATF4 |
Synonyms : | ATF4; activating transcription factor 4 (tax-responsive enhancer element B67); TXREB; cyclic AMP-dependent transcription factor ATF-4; CREB 2; TAXREB67; |
Gene ID : | 468 |
mRNA Refseq : | NM_001675 |
Protein Refseq : | NP_001666 |
MIM : | 604064 |
Uniprot ID : | P18848 |
Chromosome Location : | 22q13.1 |
Pathway : | Cholinergic synapse, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; GnRH signaling pathway, organism-specific biosystem; |
Function : | DNA binding; DNA binding; protein binding; protein dimerization activity; sequence-specific DNA binding; |
Products Types
◆ Recombinant Protein | ||
ATF4-267R | Recombinant Rhesus Macaque ATF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATF4-813M | Recombinant Mouse ATF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATF4-3596H | Recombinant Human ATF4, His Cam-tagged | +Inquiry |
Atf4-184R | Recombinant Rat Atf4 protein, His&Myc-tagged | +Inquiry |
ATF4-2067M | Recombinant Mouse ATF4 Protein | +Inquiry |
◆ Lysates | ||
ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket