Recombinant Human ATF6, GST-tagged
| Cat.No. : | ATF6-873H |
| Product Overview : | Recombinant Human ATF6 (1 a.a. - 202 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-202 a.a. |
| Description : | ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ERmolecules. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | Theoretical MW (kDa): 48.5 |
| AA Sequence : | MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWD INNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT |
| Applications : | AP, Array, ELISA, WB-Re |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ATF6 activating transcription factor 6 [ Homo sapiens ] |
| Official Symbol | ATF6 |
| Synonyms | ATF6A; cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha |
| Gene ID | 22926 |
| mRNA Refseq | NM_007348 |
| Protein Refseq | NP_031374 |
| MIM | 605537 |
| UniProt ID | P18850 |
| Chromosome Location | 1q23.3 |
| Pathway | ATF4 activates genes, organism-specific biosystem; Alzheimer's disease, conserved biosystem; Metabolism of proteins, organism-specific biosystem |
| Function | RNA polymerase II regulatory region sequence-specific DNA binding; cAMP response element binding; protein binding |
| ◆ Recombinant Proteins | ||
| ATF6-873H | Recombinant Human ATF6, GST-tagged | +Inquiry |
| ATF6-0152H | Recombinant Human ATF6 Protein (Met1-Thr192), N-His-tagged | +Inquiry |
| RFL-3371HF | Recombinant Full Length Human Cyclic Amp-Dependent Transcription Factor Atf-6 Alpha(Atf6) Protein, His-Tagged | +Inquiry |
| ATF6-841R | Recombinant Rat ATF6 Protein | +Inquiry |
| ATF6-6204Z | Recombinant Zebrafish ATF6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATF6-144HCL | Recombinant Human ATF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATF6 Products
Required fields are marked with *
My Review for All ATF6 Products
Required fields are marked with *
