Recombinant Human ATG3, His-tagged

Cat.No. : ATG3-35H
Product Overview : Recombinant Human Ubiquitin-Like-Conjugating Enzyme ATG3/ATG3 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-His287) of Human ATG3 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) is widely expressed and has highly levels in heart, skeletal muscle, kidney, liver and placenta. ATG3 as a E2-like enzyme, involves in autophagy and mitochondrial homeostasis. ATG3 catalyzes the conjugation of ATG8-like proteins to PE which is essential for autophagy. As an autocatalytic E2-like enzyme, ATG3 also can catalyzes the conjugation of ATG12 to itself which palys a role in mitochondrial homeostasis but not in autophagy.
Form : Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence : MASMTGGQQMGRGSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCP TWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGI TGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEA CKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVT IENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHLEHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG3
Synonyms ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE;
Gene ID 64422
mRNA Refseq NM_022488
Protein Refseq NP_071933
MIM 609606
UniProt ID Q9NT62
Chromosome Location 3q13.2
Pathway Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem;
Function Atg12 ligase activity; Atg8 ligase activity; enzyme binding; ligase activity; protein binding; small conjugating protein ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG3 Products

Required fields are marked with *

My Review for All ATG3 Products

Required fields are marked with *

0
cart-icon
0
compare icon