Recombinant Human ATG3, His-tagged
Cat.No. : | ATG3-35H |
Product Overview : | Recombinant Human Ubiquitin-Like-Conjugating Enzyme ATG3/ATG3 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-His287) of Human ATG3 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Ubiquitin-Like-Conjugating Enzyme ATG3 (ATG3) is widely expressed and has highly levels in heart, skeletal muscle, kidney, liver and placenta. ATG3 as a E2-like enzyme, involves in autophagy and mitochondrial homeostasis. ATG3 catalyzes the conjugation of ATG8-like proteins to PE which is essential for autophagy. As an autocatalytic E2-like enzyme, ATG3 also can catalyzes the conjugation of ATG12 to itself which palys a role in mitochondrial homeostasis but not in autophagy. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | MASMTGGQQMGRGSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCP TWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGI TGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEA CKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVT IENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHLEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG3 |
Synonyms | ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE; |
Gene ID | 64422 |
mRNA Refseq | NM_022488 |
Protein Refseq | NP_071933 |
MIM | 609606 |
UniProt ID | Q9NT62 |
Chromosome Location | 3q13.2 |
Pathway | Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; Senescence and Autophagy, organism-specific biosystem; |
Function | Atg12 ligase activity; Atg8 ligase activity; enzyme binding; ligase activity; protein binding; small conjugating protein ligase activity; |
◆ Recombinant Proteins | ||
ATG3-947H | Recombinant Human ATG3 protein, GST-tagged | +Inquiry |
ATG3-1273HF | Recombinant Full Length Human ATG3 Protein, GST-tagged | +Inquiry |
ATG3-2081M | Recombinant Mouse ATG3 Protein | +Inquiry |
ATG3-1065HFL | Recombinant Full Length Human ATG3 Protein, C-Flag-tagged | +Inquiry |
ATG3-844R | Recombinant Rat ATG3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG3-8625HCL | Recombinant Human ATG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG3 Products
Required fields are marked with *
My Review for All ATG3 Products
Required fields are marked with *
0
Inquiry Basket