Recombinant Human ATG4C protein, GST-tagged

Cat.No. : ATG4C-950H
Product Overview : Human ATG4C full-length ORF ( NP_116241.2, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized. [provided by RefSeq, Jul 2008]
Molecular Mass : 78.9 kDa
AA Sequence : MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATG4C ATG4 autophagy related 4 homolog C (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG4C
Synonyms ATG4C; ATG4 autophagy related 4 homolog C (S. cerevisiae); APG4 autophagy 4 homolog C (S. cerevisiae) , APG4C, AUT (S. cerevisiae) like 1, cysteine endopeptidase; AUT like 1, cysteine endopeptidase (S. cerevisiae) , AUTL1; cysteine protease ATG4C; AUTL3; FLJ14867; autophagin-3; APG4 autophagy 4 homolog C; AUT-like 3 cysteine endopeptidase; AUT-like 1, cysteine endopeptidase; autophagy-related protein 4 homolog C; autophagy-related cysteine endopeptidase 3; APG4C; AUTL1; APG4-C;
Gene ID 84938
mRNA Refseq NM_032852
Protein Refseq NP_116241
MIM 611339
UniProt ID Q96DT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG4C Products

Required fields are marked with *

My Review for All ATG4C Products

Required fields are marked with *

0
cart-icon
0
compare icon