Recombinant Human ATG5 protein, T7-tagged

Cat.No. : ATG5-174H
Product Overview : Recombinant human APG5L (275 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 275 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSMTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQK VMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEAD ALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAA DGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro autophage / apoptosis regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development and cancer diagnostic development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ATG5 ATG5 autophagy related 5 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG5
Synonyms ATG5; ATG5 autophagy related 5 homolog (S. cerevisiae); APG5 (autophagy 5, S. cerevisiae) like , APG5 autophagy 5 like (S. cerevisiae) , APG5L; autophagy protein 5; APG5; ASP; hAPG5; apoptosis specific protein; apoptosis-specific protein; APG5L; APG5-LIKE;
Gene ID 9474
mRNA Refseq NM_004849
Protein Refseq NP_004840
MIM 604261
UniProt ID Q9H1Y0
Chromosome Location 6q21
Pathway Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Negative regulators of RIG-I/MDA5 signaling, organism-specific biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem; RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways, organism-specific biosystem; Regulation of autophagy, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG5 Products

Required fields are marked with *

My Review for All ATG5 Products

Required fields are marked with *

0
cart-icon