Recombinant Human ATG5 protein, T7-tagged
| Cat.No. : | ATG5-174H |
| Product Overview : | Recombinant human APG5L (275 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 275 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFGSMTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQK VMRQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMKEAD ALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVAA DGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro autophage / apoptosis regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development and cancer diagnostic development. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | ATG5 ATG5 autophagy related 5 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ATG5 |
| Synonyms | ATG5; ATG5 autophagy related 5 homolog (S. cerevisiae); APG5 (autophagy 5, S. cerevisiae) like , APG5 autophagy 5 like (S. cerevisiae) , APG5L; autophagy protein 5; APG5; ASP; hAPG5; apoptosis specific protein; apoptosis-specific protein; APG5L; APG5-LIKE; |
| Gene ID | 9474 |
| mRNA Refseq | NM_004849 |
| Protein Refseq | NP_004840 |
| MIM | 604261 |
| UniProt ID | Q9H1Y0 |
| Chromosome Location | 6q21 |
| Pathway | Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Negative regulators of RIG-I/MDA5 signaling, organism-specific biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem; RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways, organism-specific biosystem; Regulation of autophagy, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| ATG5-020H | Recombinant Human ATG5 Protein, His-tagged | +Inquiry |
| ATG5-73H | Recombinant Human ATG5 Autophagy Related 5 Homolog, T7-tagged | +Inquiry |
| ATG5-951H | Recombinant Human ATG5 protein, GST-tagged | +Inquiry |
| ATG5-2085M | Recombinant Mouse ATG5 Protein | +Inquiry |
| ATG5-1551C | Recombinant Chicken ATG5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATG5-059HKCL | Human ATG5 Knockdown Cell Lysate | +Inquiry |
| ATG5-8622HCL | Recombinant Human ATG5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG5 Products
Required fields are marked with *
My Review for All ATG5 Products
Required fields are marked with *



