Recombinant Human ATL2 protein, His-tagged
| Cat.No. : | ATL2-9986H |
| Product Overview : | Recombinant Human ATL2 protein(NP_001129145)(1-313 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-313 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ATL2 atlastin GTPase 2 [ Homo sapiens ] |
| Official Symbol | ATL2 |
| Synonyms | ATL2; atlastin GTPase 2; ADP ribosylation factor like 6 interacting protein 2 , ARL6IP2; atlastin-2; aip-2; ARL-6-interacting protein 2; ADP-ribosylation factor-like 6 interacting protein 2; ADP-ribosylation-like factor 6 interacting protein 2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL3IP2; ARL6IP2; atlastin2; FLJ23293; |
| Gene ID | 64225 |
| mRNA Refseq | NM_001135673 |
| Protein Refseq | NP_001129145 |
| MIM | 609368 |
| UniProt ID | Q8NHH9 |
| ◆ Recombinant Proteins | ||
| ATL2-9985H | Recombinant Human ATL2, GST-tagged | +Inquiry |
| ATL2-6089Z | Recombinant Zebrafish ATL2 | +Inquiry |
| RFL3185HF | Recombinant Full Length Human Atlastin-2(Atl2) Protein, His-Tagged | +Inquiry |
| ARL6IP2-818H | Recombinant Human ARL6IP2 protein, GST-tagged | +Inquiry |
| ATL2-2092M | Recombinant Mouse ATL2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATL2-122HCL | Recombinant Human ATL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATL2 Products
Required fields are marked with *
My Review for All ATL2 Products
Required fields are marked with *
