Recombinant Human ATL2 protein, His-tagged

Cat.No. : ATL2-9986H
Product Overview : Recombinant Human ATL2 protein(NP_001129145)(1-313 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-313 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ATL2 atlastin GTPase 2 [ Homo sapiens ]
Official Symbol ATL2
Synonyms ATL2; atlastin GTPase 2; ADP ribosylation factor like 6 interacting protein 2 , ARL6IP2; atlastin-2; aip-2; ARL-6-interacting protein 2; ADP-ribosylation factor-like 6 interacting protein 2; ADP-ribosylation-like factor 6 interacting protein 2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL3IP2; ARL6IP2; atlastin2; FLJ23293;
Gene ID 64225
mRNA Refseq NM_001135673
Protein Refseq NP_001129145
MIM 609368
UniProt ID Q8NHH9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATL2 Products

Required fields are marked with *

My Review for All ATL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon