Recombinant Human ATP11C protein, GST-tagged

• Cat.No.: ATP11C-960H
• Product Overview: Human ATP11C partial ORF ( NP_775965, 441 a.a. - 545 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ATP11C (ATPase Phospholipid Transporting 11C) is a Protein Coding gene. Among its related pathways are Ion channel transport and Cardiac conduction. GO annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP11A.
• Molecular Mass: 37.29 kDa
• AA Sequence: VDGLSQTDGTLTYFDKVDKNREELFLRALCLCHTVEIKTNDAVDGATESAELTYISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHTLNFDA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP11C ATPase, class VI, type 11C [ Homo sapiens ]
• Official Symbol: ATP11C
• Synonyms: ATP11C; ATPase, class VI, type 11C; ATPase, Class VI, type 11C; probable phospholipid-transporting ATPase IG; ATPIG; ATPIQ; phospholipid-transporting ATPase IG
• Gene ID: 286410
• mRNA Refseq: NM_001010986
• Protein Refseq: NP_001010986
• MIM: 300516
• UniProt ID: Q8NB49