Recombinant Human ATP11C protein, GST-tagged

Cat.No. : ATP11C-960H
Product Overview : Human ATP11C partial ORF ( NP_775965, 441 a.a. - 545 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ATP11C (ATPase Phospholipid Transporting 11C) is a Protein Coding gene. Among its related pathways are Ion channel transport and Cardiac conduction. GO annotations related to this gene include nucleotide binding and cation-transporting ATPase activity. An important paralog of this gene is ATP11A.
Molecular Mass : 37.29 kDa
AA Sequence : VDGLSQTDGTLTYFDKVDKNREELFLRALCLCHTVEIKTNDAVDGATESAELTYISSSPDEIALVKGAKRYGFTFLGNRNGYMRVENQRKEIEEYELLHTLNFDA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP11C ATPase, class VI, type 11C [ Homo sapiens ]
Official Symbol ATP11C
Synonyms ATP11C; ATPase, class VI, type 11C; ATPase, Class VI, type 11C; probable phospholipid-transporting ATPase IG; ATPIG; ATPIQ; phospholipid-transporting ATPase IG;
Gene ID 286410
mRNA Refseq NM_001010986
Protein Refseq NP_001010986
MIM 300516
UniProt ID Q8NB49

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP11C Products

Required fields are marked with *

My Review for All ATP11C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon