Recombinant Human ATP13A2 protein, GST-tagged
Cat.No. : | ATP13A2-962H |
Product Overview : | Human ATP13A2 partial ORF ( NP_071372, 68 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2008] |
Molecular Mass : | 35.31 kDa |
AA Sequence : | KPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP13A2 ATPase type 13A2 [ Homo sapiens ] |
Official Symbol | ATP13A2 |
Synonyms | ATP13A2; ATPase type 13A2; PARK9, Parkinson disease (autosomal recessive) 9 (Kufor Rakeb syndrome); probable cation-transporting ATPase 13A2; CLN12; HSA9947; putative ATPase; KRPPD; PARK9; RP1-37C10.4; FLJ26510; |
Gene ID | 23400 |
mRNA Refseq | NM_001141973 |
Protein Refseq | NP_001135445 |
MIM | 610513 |
UniProt ID | Q9NQ11 |
◆ Recombinant Proteins | ||
ATP13A2-4981Z | Recombinant Zebrafish ATP13A2 | +Inquiry |
ATP13A2-962H | Recombinant Human ATP13A2 protein, GST-tagged | +Inquiry |
ATP13A2-2572C | Recombinant Chicken ATP13A2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP13A2 Products
Required fields are marked with *
My Review for All ATP13A2 Products
Required fields are marked with *