Recombinant Human ATP13A2 protein, GST-tagged

Cat.No. : ATP13A2-962H
Product Overview : Human ATP13A2 partial ORF ( NP_071372, 68 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2008]
Molecular Mass : 35.31 kDa
AA Sequence : KPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP13A2 ATPase type 13A2 [ Homo sapiens ]
Official Symbol ATP13A2
Synonyms ATP13A2; ATPase type 13A2; PARK9, Parkinson disease (autosomal recessive) 9 (Kufor Rakeb syndrome); probable cation-transporting ATPase 13A2; CLN12; HSA9947; putative ATPase; KRPPD; PARK9; RP1-37C10.4; FLJ26510;
Gene ID 23400
mRNA Refseq NM_001141973
Protein Refseq NP_001135445
MIM 610513
UniProt ID Q9NQ11

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP13A2 Products

Required fields are marked with *

My Review for All ATP13A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon