Recombinant Human ATP1A3 protein(171-240 aa), C-His-tagged
Cat.No. : | ATP1A3-2649H |
Product Overview : | Recombinant Human ATP1A3 protein(P13637)(171-240 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 171-240 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV |
Gene Name | ATP1A3 ATPase, Na+/K+ transporting, alpha 3 polypeptide [ Homo sapiens ] |
Official Symbol | ATP1A3 |
Synonyms | ATP1A3; ATPase, Na+/K+ transporting, alpha 3 polypeptide; dystonia 12 , DYT12; sodium/potassium-transporting ATPase subunit alpha-3; Na+/K+ ATPase 3; sodium pump subunit alpha-3; Na(+)/K(+) ATPase alpha-3 subunit; Na(+)/K(+) ATPase alpha(III) subunit; sodium-potassium-ATPase, alpha 3 polypeptide; sodium/potassium-transporting ATPase alpha-3 chain; RDP; DYT12; MGC13276; |
Gene ID | 478 |
mRNA Refseq | NM_001256213 |
Protein Refseq | NP_001243142 |
MIM | 182350 |
UniProt ID | P13637 |
◆ Recombinant Proteins | ||
ATP1A3-277R | Recombinant Rhesus Macaque ATP1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP1A3-3253H | Recombinant Human ATP1A3 protein, His-tagged | +Inquiry |
ATP1A3-7024C | Recombinant Chicken ATP1A3 | +Inquiry |
ATP1A3-854R | Recombinant Rat ATP1A3 Protein | +Inquiry |
ATP1A3-510R | Recombinant Rat ATP1A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1A3-8611HCL | Recombinant Human ATP1A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP1A3 Products
Required fields are marked with *
My Review for All ATP1A3 Products
Required fields are marked with *