Recombinant Human ATP1A3 protein, GST-tagged

Cat.No. : ATP1A3-3256H
Product Overview : Recombinant Human ATP1A3 protein(1-65 aa), fused with GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-65 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name ATP1A3 ATPase, Na+/K+ transporting, alpha 3 polypeptide [ Homo sapiens ]
Official Symbol ATP1A3
Synonyms ATP1A3; ATPase, Na+/K+ transporting, alpha 3 polypeptide; dystonia 12 , DYT12; sodium/potassium-transporting ATPase subunit alpha-3; Na+/K+ ATPase 3; sodium pump subunit alpha-3; Na(+)/K(+) ATPase alpha-3 subunit; Na(+)/K(+) ATPase alpha(III) subunit; sodium-potassium-ATPase, alpha 3 polypeptide; sodium/potassium-transporting ATPase alpha-3 chain; RDP; DYT12; MGC13276
Gene ID 478
mRNA Refseq NM_001256213
Protein Refseq NP_001243142
MIM 182350
UniProt ID P13637

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP1A3 Products

Required fields are marked with *

My Review for All ATP1A3 Products

Required fields are marked with *

0
cart-icon