Recombinant Human ATP2A1 Protein, His-tagged
Cat.No. : | ATP2A1-10010H |
Product Overview : | Recombinant Human ATP2A1 Protein(1-46 aa), fused with His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 561-635 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [ Homo sapiens ] |
Official Symbol | ATP2A1 |
Synonyms | ATP2A1; ATPase, Ca++ transporting, cardiac muscle, fast twitch 1; ATP2A; sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA1; calcium pump 1; SR Ca(2+)-ATPase 1; endoplasmic reticulum class 1/2 Ca(2+) ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform |
Gene ID | 487 |
mRNA Refseq | NM_004320 |
Protein Refseq | NP_004311 |
MIM | 108730 |
UniProt ID | O14983 |
◆ Recombinant Proteins | ||
ATP2A1-1520HFL | Recombinant Full Length Human ATP2A1 Protein, C-Flag-tagged | +Inquiry |
Atp2a1-666M | Recombinant Mouse Atp2a1 Protein, MYC/DDK-tagged | +Inquiry |
ATP2A1-6120H | Recombinant Human ATP2A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP2A1-7068C | Recombinant Chicken ATP2A1 | +Inquiry |
ATP2A1-1244HF | Recombinant Full Length Human ATP2A1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP2A1 Products
Required fields are marked with *
My Review for All ATP2A1 Products
Required fields are marked with *