Recombinant Human ATP2A1 Protein, His-tagged

Cat.No. : ATP2A1-10010H
Product Overview : Recombinant Human ATP2A1 Protein(1-46 aa), fused with His tag, was expressed in E. coli.
Availability July 05, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 561-635 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ATP2A1 ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [ Homo sapiens ]
Official Symbol ATP2A1
Synonyms ATP2A1; ATPase, Ca++ transporting, cardiac muscle, fast twitch 1; ATP2A; sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA1; calcium pump 1; SR Ca(2+)-ATPase 1; endoplasmic reticulum class 1/2 Ca(2+) ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform
Gene ID 487
mRNA Refseq NM_004320
Protein Refseq NP_004311
MIM 108730
UniProt ID O14983

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP2A1 Products

Required fields are marked with *

My Review for All ATP2A1 Products

Required fields are marked with *

0
cart-icon