Recombinant Human ATP4B
Cat.No. : | ATP4B-29416TH |
Product Overview : | Recombinant fragment of Human Hydrogen Potassium ATPase Beta with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTW ADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPN HTKFSCKFTADMLQNCSGLADPNFGFEEGK |
Gene Name | ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ] |
Official Symbol | ATP4B |
Synonyms | ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B; |
Gene ID | 496 |
mRNA Refseq | NM_000705 |
Protein Refseq | NP_000696 |
MIM | 137217 |
Uniprot ID | P51164 |
Chromosome Location | 13q34 |
Pathway | Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Ion channel transport, organism-specific biosystem; |
Function | hydrogen:potassium-exchanging ATPase activity; sodium:potassium-exchanging ATPase activity; |
◆ Recombinant Proteins | ||
Atp4b-490M | Recombinant Mouse Atp4b protein, His-tagged | +Inquiry |
RFL-22870MF | Recombinant Full Length Mouse Potassium-Transporting Atpase Subunit Beta(Atp4B) Protein, His-Tagged | +Inquiry |
ATP4B-5988C | Recombinant Chicken ATP4B | +Inquiry |
ATP4B-522R | Recombinant Rat ATP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP4B-858M | Recombinant Mouse ATP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP4B Products
Required fields are marked with *
My Review for All ATP4B Products
Required fields are marked with *