Recombinant Human ATP4B protein, GST-tagged
Cat.No. : | ATP4B-2943H |
Product Overview : | Recombinant Human ATP4B(1 a.a. - 291 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-291 a.a. |
Description : | The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 57.75 kDa |
AA Sequence : | MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQD QLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKF SCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTF SLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ] |
Official Symbol | ATP4B |
Synonyms | ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B; proton pump beta chain; gastric H+/K+ ATPase beta subunit; gastric H(+)/K(+) ATPase subunit beta; gastric hydrogen-potassium ATPase, beta; potassium-transporting ATPase beta chain; ATPase, H+/K+ transporting, beta polypeptide; |
Gene ID | 496 |
mRNA Refseq | NM_000705 |
Protein Refseq | NP_000696 |
MIM | 137217 |
UniProt ID | P51164 |
Chromosome Location | 13q34 |
Pathway | Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Ion channel transport, organism-specific biosystem; Ion transport by P-type ATPases, organism-specific biosystem; Oxidative phosphorylation, organism-specific biosystem; |
Function | hydrogen:potassium-exchanging ATPase activity; sodium:potassium-exchanging ATPase activity; |
◆ Recombinant Proteins | ||
ATP4B-858M | Recombinant Mouse ATP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-2437SF | Recombinant Full Length Pig Potassium-Transporting Atpase Subunit Beta(Atp4B) Protein, His-Tagged | +Inquiry |
ATP4B-2128M | Recombinant Mouse ATP4B Protein | +Inquiry |
ATP4B-5988C | Recombinant Chicken ATP4B | +Inquiry |
Atp4b-490M | Recombinant Mouse Atp4b protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP4B Products
Required fields are marked with *
My Review for All ATP4B Products
Required fields are marked with *
0
Inquiry Basket