Recombinant Human ATP5F1D Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | ATP5F1D-432H |
Product Overview : | ATP5D MS Standard C13 and N15-labeled recombinant protein (NP_001001975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ATP5F1D ATP synthase F1 subunit delta [ Homo sapiens (human) ] |
Official Symbol | ATP5F1D |
Synonyms | ATP5F1D; ATP synthase F1 subunit delta; ATP5D; MC5DN5; ATP synthase subunit delta, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit; F-ATPase delta subunit; mitochondrial ATP synthase complex delta-subunit precusor; mitochondrial ATP synthase, delta subunit; EC 3.6.1.14 |
Gene ID | 513 |
mRNA Refseq | NM_001001975 |
Protein Refseq | NP_001001975 |
MIM | 603150 |
UniProt ID | P30049 |
◆ Recombinant Proteins | ||
ATP5F1D-432H | Recombinant Human ATP5F1D Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP5F1D-0284H | Recombinant Human ATP5F1D Protein (Met1-Glu168), N-His-tagged | +Inquiry |
ATP5F1D-2998H | Recombinant Human ATP5F1D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5F1D Products
Required fields are marked with *
My Review for All ATP5F1D Products
Required fields are marked with *
0
Inquiry Basket