Recombinant Human ATP5H protein, GST-tagged
Cat.No. : | ATP5H-985H |
Product Overview : | Human ATP5H full-length ORF ( NP_006347.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP5H ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d [ Homo sapiens ] |
Official Symbol | ATP5H |
Synonyms | ATP5H; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d; ATP synthase subunit d, mitochondrial; ATP5JD; ATPQ; My032 protein; ATPase subunit d; ATP synthase D chain, mitochondrial; ATP synthase, H+ transporting, mitochondrial F1F0, subunit d; |
Gene ID | 10476 |
mRNA Refseq | NM_001003785 |
Protein Refseq | NP_001003785 |
UniProt ID | O75947 |
◆ Recombinant Proteins | ||
ATP5H-1122HF | Recombinant Full Length Human ATP5H Protein, GST-tagged | +Inquiry |
ATP5H-875R | Recombinant Rat ATP5H Protein | +Inquiry |
ATP5H-863M | Recombinant Mouse ATP5H Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5H-3744H | Recombinant Human ATP5H protein, His-tagged | +Inquiry |
ATP5H-288R | Recombinant Rhesus Macaque ATP5H Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5H-8599HCL | Recombinant Human ATP5H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5H Products
Required fields are marked with *
My Review for All ATP5H Products
Required fields are marked with *